ID X62664; SV 1; linear; genomic RNA; STD; VRL; 339 BP. XX AC X62664; XX DT 09-JUN-1992 (Rel. 32, Created) DT 09-JUN-1992 (Rel. 32, Last updated, Version 2) XX DE Cymbidium mosaic virus RNA for 14Kd protein XX KW cell-to-cell transport protein; CyMV. XX OS Cymbidium mosaic virus OC Viruses; Riboviria; Tymovirales; Alphaflexiviridae; Potexvirus. XX RN [1] RP 1-339 RA Neo K.N.; RT ; RL Submitted (15-OCT-1991) to the INSDC. RL K.N. Neo, c/o Dr Wong Sek Man, National University of Singapore, Dept of RL Botany Faculty of Science, Lower Kent Ridge Road, 0511, SINGAPORE XX RN [2] RP 1-339 RX DOI; 10.1007/BF00019225. RX PUBMED; 1581564. RA Neo K.K., Wong S.M., Wu M.; RT "Nucleotide sequences of the two ORFs upstream to the coat protein gene of RT cymbidium mosaic virus"; RL Plant Mol. Biol. 18(5):1027-1029(1992). XX DR MD5; 890fd8de89561d8d4ee0b837cab41c82. XX FH Key Location/Qualifiers FH FT source 1..339 FT /organism="Cymbidium mosaic virus" FT /strain="Singapore" FT /mol_type="genomic RNA" FT /clone_lib="cDNA library" FT /clone="pCYM46" FT /db_xref="taxon:12178" FT CDS 1..339 FT /gene="14kD ORF" FT /db_xref="InterPro:IPR001896" FT /db_xref="UniProtKB/Swiss-Prot:Q00479" FT /protein_id="CAA44531.1" FT /translation="MPGLVPPPDHSKSLFVLAIGITVVSALFVLKSHTFPIAGDNIHRF FT PSGGQYKDGTKQINYCPPTHARYPKYPDYKWLAATAAIVIPLCLYISYHPGNNIRRICP FT CCNTYHHP" XX SQ Sequence 339 BP; 80 A; 112 C; 54 G; 93 T; 0 other; atgccaggct tagttccacc acctgaccac tccaagtcac tctttgtcct tgctattggc 60 ataactgtgg tctccgcact atttgtgcta aagtcccaca cttttccaat tgcaggcgac 120 aatattcacc gcttcccctc cggcggccaa tataaagacg gtactaagca gataaactac 180 tgtccaccta ctcatgctag gtacccgaaa tatcccgact acaagtggct tgccgctacc 240 gccgccatcg tcatccctct ctgcctatat atttcctacc atcctggcaa taatattcgc 300 cgtatttgcc cttgttgcaa tacatatcac cacccctga 339 //