ID X62663; SV 1; linear; genomic RNA; STD; VRL; 276 BP. XX AC X62663; XX DT 09-JUN-1992 (Rel. 32, Created) DT 09-JUN-1992 (Rel. 32, Last updated, Version 2) XX DE Cymbidium mosaic virus RNA for 11Kd protein XX KW cell-to-cell transport protein; CyMV. XX OS Cymbidium mosaic virus OC Viruses; Riboviria; Tymovirales; Alphaflexiviridae; Potexvirus. XX RN [1] RP 1-276 RA Neo K.N.; RT ; RL Submitted (15-OCT-1991) to the INSDC. RL K.N. Neo, c/o Dr Wong Sek Man, National University of Singapore, Dept of RL Botany Faculty of Science, Lower Kent Ridge Road, 0511, SINGAPORE XX RN [2] RP 1-276 RX DOI; 10.1007/BF00019225. RX PUBMED; 1581564. RA Neo K.K., Wong S.M., Wu M.; RT "Nucleotide sequences of the two ORFs upstream to the coat protein gene of RT cymbidium mosaic virus"; RL Plant Mol. Biol. 18(5):1027-1029(1992). XX DR MD5; 8d11fe6c259371784b74223b43a885c2. XX FH Key Location/Qualifiers FH FT source 1..276 FT /organism="Cymbidium mosaic virus" FT /strain="Singapore" FT /mol_type="genomic RNA" FT /clone_lib="cDNA library" FT /clone="pCYM46" FT /db_xref="taxon:12178" FT CDS 1..276 FT /gene="11KD ORF" FT /db_xref="GOA:Q00478" FT /db_xref="InterPro:IPR003411" FT /db_xref="UniProtKB/Swiss-Prot:Q00478" FT /protein_id="CAA44530.1" FT /translation="MLGTRNIPTTSGLPLPPPSSSLSAYIFPTILAIIFAVFALVAIHI FT TTPEPFCTIHIDGASITITNCPDPAAILNKVAIGPWRGLSYHNNLK" XX SQ Sequence 276 BP; 73 A; 82 C; 46 G; 75 T; 0 other; atgctaggta cccgaaatat cccgactaca agtggcttgc cgctaccgcc gccatcgtca 60 tccctctctg cctatatatt tcctaccatc ctggcaataa tattcgccgt atttgccctt 120 gttgcaatac atatcaccac ccctgagcct ttctgtacca tacacataga cggggcgtct 180 attactatca ctaactgccc cgatcctgca gctatattaa ataaagtagc tataggcccc 240 tggcgagggt taagttacca caataacttg aaataa 276 //