ID X55897; SV 1; linear; genomic RNA; STD; VRL; 393 BP. XX AC X55897; XX DT 29-OCT-1990 (Rel. 25, Created) DT 12-SEP-1993 (Rel. 36, Last updated, Version 2) XX DE Carnation latent virus (CLV) 3' terminal ORF XX KW . XX OS Carnation latent virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-393 RA Coutts R.H.A.; RT ; RL Submitted (04-SEP-1990) to the INSDC. RL Coutts R.H.A., Biology Department, Imperial College of Science and RL Technology, Prince Consort Road, London SW7 2BB, U K. XX RN [2] RX DOI; 10.1093/nar/18.20.6127. RX PUBMED; 2235495. RA Haylor T.M., Brunt A.A., Coutts R.H.A.; RT "Conservation of the 3' terminal nucleotide sequence in five carlaviruses"; RL Nucleic Acids Res. 18(20):6127-6127(1990). XX DR MD5; d02dd78495785089d6866a1df395260d. DR EuropePMC; PMC3999073; 23759549. XX FH Key Location/Qualifiers FH FT source 1..393 FT /organism="Carnation latent virus" FT /mol_type="genomic RNA" FT /db_xref="taxon:12164" FT CDS 32..337 FT /note="3' terminal ORF" FT /db_xref="GOA:P22625" FT /db_xref="InterPro:IPR002568" FT /db_xref="UniProtKB/Swiss-Prot:P22625" FT /protein_id="CAA39386.1" FT /translation="MRERKLRKQLEDLFKRFASVQHGHSDCINIIIAKIKSDQPGESKY FT ARRRRAKSIARCPRCARVSPGFYFTTRCDGKTCRPGLSARPDLLEFIGIDLCVRSK" XX SQ Sequence 393 BP; 122 A; 68 C; 88 G; 115 T; 0 other; cgaactttaa cggttcgaac aattcagact aatgcgtgag agaaagctaa ggaagcagct 60 tgaggacctg ttcaagcgtt tcgcatctgt gcaacatggg cactctgatt gtattaatat 120 tataatagca aaaataaaga gtgatcaacc tggggagagt aaatatgcac ggcgacgtag 180 agctaagtca atagcccgat gtccaaggtg cgcacgcgta tctcctggtt tttacttcac 240 cactcgttgt gatggtaaga catgcagacc tggtttatca gcccgaccag atttgttaga 300 atttattggg attgacttgt gtgtaagatc taagtaatat ataagcactt aagtataaaa 360 agaaaatgcg ttttaaatat ttttccgtat ttt 393 //