ID X17261; SV 1; linear; genomic RNA; STD; VRL; 603 BP. XX AC X17261; XX DT 12-APR-1991 (Rel. 28, Created) DT 07-JUL-2003 (Rel. 76, Last updated, Version 15) XX DE Barley yellow dwarf virus (isolate P-PAV) coat protein gene XX KW coat protein. XX OS Barley yellow dwarf virus OC Viruses; Riboviria; Luteoviridae; Luteovirus; unclassified Luteovirus. XX RN [3] RX PUBMED; 2273382. RA Vincent J.R., Ueng P.P., Lister R.M., Larkins B.A.; RT "Nucleotide sequences of coat protein genes for three isolates of barley RT yellow dwarf virus and their relationships to other luteovirus coat protein RT sequences"; RL J. Gen. Virol. 71:2791-2799(1990). XX RN [4] RP 1-603 RA Vincent J.R.; RT ; RL Submitted (07-DEC-1989) to the INSDC. RL Vincent J.R., Purdue University, Department of Botany and Plant Pathology, RL West Lafayette , Indiana 47907, U S A. XX DR MD5; efbc782af63b111a4837c28eba976917. XX FH Key Location/Qualifiers FH FT source 1..603 FT /organism="Barley yellow dwarf virus" FT /isolate="P-PAV" FT /mol_type="genomic RNA" FT /clone="209,165,45" FT /db_xref="taxon:12037" FT CDS 1..603 FT /product="viral coat protein" FT /db_xref="GOA:Q00011" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/Swiss-Prot:Q00011" FT /protein_id="CAA35164.1" FT /translation="MNSVGRRGPRRANQNGTRRRRRRTVRPVVVVQPNRAGPRRRNGRR FT KGRGGANPVFRPTGGTEVFVFSVDNLKANSSGAIKFGPSLSQCPALSDGILKSYHRYKI FT TSIRVEFKSHASATTAGAIFIELDTACKQSALGSYINSFTISRTAAKVFRAEAINGKEF FT QESTIDQFWMLYKANGTTTDTAGQFIITMSVSLMTAK" FT CDS 44..505 FT /note="internal reading frame" FT /db_xref="GOA:P29047" FT /db_xref="InterPro:IPR001964" FT /db_xref="UniProtKB/Swiss-Prot:P29047" FT /protein_id="CAA35165.1" FT /translation="MAQEGGAVEQFGQWLWSNPIEQDPDDEMVDAREEEGQILYLDQQA FT GLRYSYSQSTTLKPTPPGQSNSAPVYRNAQRFQTEYLSPTTVTRSQVSVLSLSHTRPQL FT RPALSLLNSTPRANNQPWVATLIPSQSAGPPQRSSEPKRLTGRNSRNQR" XX SQ Sequence 603 BP; 179 A; 156 C; 150 G; 118 T; 0 other; atgaattcag taggccgtag aggacctaga cgcgcaaatc aaaatggcac aagaaggagg 60 cgccgtagaa cagttcggcc agtggttgtg gtccaaccca atcgagcagg acccagacga 120 cgaaatggtc gacgcaaggg aagaggaggg gcaaatcctg tatttagacc aacaggcggg 180 actgaggtat tcgtattctc agtcgacaac cttaaagcca actcctccgg ggcaatcaaa 240 ttcggcccca gtctatcgca atgcccagcg ctttcagacg gaatacttaa gtcctaccac 300 cgttacaaga tcacaagtat ccgtgttgag tttaagtcac acgcgtccgc aactacggcc 360 ggcgctatct ttattgaact cgacaccgcg tgcaaacaat cagccctggg tagctacatt 420 aattccttca caatcagcag gaccgccgca aaggtcttca gagccgaagc gattaacggg 480 aaggaattcc aggaatcaac gatagaccag ttttggatgc tctacaaggc caatggaacc 540 accactgaca cggcaggaca attcattatc acgatgagtg tcagtttgat gacggccaaa 600 tag 603 //