ID V01099; SV 1; linear; genomic RNA; STD; VRL; 1027 BP. XX AC V01099; J02145; XX DT 09-JUN-1982 (Rel. 01, Created) DT 05-JUL-2006 (Rel. 88, Last updated, Version 5) XX DE Influenza A virus (A/PR/8/1934(H1N1)) ORF1 and ORF2, genomic RNA XX KW ORF1; ORF2. XX OS Influenza A virus (A/Puerto Rico/8/1934(H1N1)) OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Insthoviricetes; OC Articulavirales; Orthomyxoviridae; Alphainfluenzavirus. XX RN [1] RP 1-1027 RX DOI; 10.1093/nar/8.9.1965. RX PUBMED; 6927841. RA Winter G., Fields S.; RT "Cloning of influenza cDNA ino M13: the sequence of the RNA segment RT encoding the A/PR/8/34 matrix protein"; RL Nucleic Acids Res. 8(9):1965-1974(1980). XX DR MD5; 0784f02be0f18e1a42355c66b1b39180. DR EuropePMC; PMC2643796; 19052087. DR EuropePMC; PMC87799; 11158130. XX FH Key Location/Qualifiers FH FT source 1..1027 FT /organism="Influenza A virus (A/Puerto Rico/8/1934(H1N1))" FT /segment="7" FT /strain="A/PR/8/1934" FT /serotype="H1N1" FT /mol_type="genomic RNA" FT /db_xref="taxon:211044" FT CDS 26..784 FT /note="ORF1" FT /db_xref="GOA:P03485" FT /db_xref="InterPro:IPR001561" FT /db_xref="InterPro:IPR013188" FT /db_xref="InterPro:IPR015423" FT /db_xref="InterPro:IPR015799" FT /db_xref="InterPro:IPR036039" FT /db_xref="InterPro:IPR037533" FT /db_xref="PDB:1AA7" FT /db_xref="PDB:1EA3" FT /db_xref="PDB:1HHI" FT /db_xref="PDB:2VLL" FT /db_xref="PDB:2VLR" FT /db_xref="PDB:3VDX" FT /db_xref="PDB:4D9J" FT /db_xref="PDB:4IQ4" FT /db_xref="PDB:4ITV" FT /db_xref="PDB:4IVJ" FT /db_xref="PDB:4QES" FT /db_xref="PDB:4QF0" FT /db_xref="PDB:4QFF" FT /db_xref="PDB:5CQE" FT /db_xref="PDB:5E6I" FT /db_xref="PDB:5EUO" FT /db_xref="PDB:5ISZ" FT /db_xref="PDB:5JHD" FT /db_xref="PDB:5TEZ" FT /db_xref="UniProtKB/Swiss-Prot:P03485" FT /protein_id="CAA24282.1" FT /translation="MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEW FT LKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLK FT REITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHR FT QMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTH FT PSSSAGLKNDLLENLQAYQKRMGVQMQRFK" FT CDS 717..1007 FT /note="ORF2" FT /db_xref="GOA:P06821" FT /db_xref="InterPro:IPR002089" FT /db_xref="PDB:5DLM" FT /db_xref="UniProtKB/Swiss-Prot:P06821" FT /protein_id="CAA24283.1" FT /translation="MIFLKICRPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDRL FT FFKCIYRRFKYGLKGGPSTEGVPKSMREEYRKEQQSAVDADDGHFVSIELE" XX SQ Sequence 1027 BP; 294 A; 217 C; 268 G; 248 T; 0 other; agcgaaagca ggtagatatt gaaagatgag tcttctaacc gaggtcgaaa cgtacgttct 60 ctctatcatc ccgtcaggcc ccctcaaagc cgagatcgca cagagacttg aagatgtctt 120 tgcagggaag aacaccgatc ttgaggttct catggaatgg ctaaagacaa gaccaatcct 180 gtcacctctg actaagggga ttttaggatt tgtgttcacg ctcaccgtgc ccagtgagcg 240 aggactgcag cgtagacgct ttgtccaaaa tgcccttaat gggaacgggg atccaaataa 300 catggacaaa gcagttaaac tgtataggaa gctcaagagg gagataacat tccatggggc 360 caaagaaatc tcactcagtt attctgctgg tgcacttgcc agttgtatgg gcctcatata 420 caacaggatg ggggctgtga ccactgaagt ggcatttggc ctggtatgtg caacctgtga 480 acagattgct gactcccagc atcggtctca taggcaaatg gtgacaacaa ccaacccact 540 aatcagacat gagaacagaa tggttttagc cagcactaca gctaaggcta tggagcaaat 600 ggctggatcg agtgagcaag cagcagaggc catggaggtt gctagtcagg ctaggcaaat 660 ggtgcaagcg atgagaacca ttgggactca tcctagctcc agtgctggtc tgaaaaatga 720 tcttcttgaa aatttgcagg cctatcagaa acgaatgggg gtgcagatgc aacggttcaa 780 gtgatcctct cgctattgcc gcaaatatca ttgggatctt gcacttgata ttgtggattc 840 ttgatcgtct ttttttcaaa tgcatttacc gtcgctttaa atacggactg aaaggagggc 900 cttctacgga aggagtgcca aagtctatga gggaagaata tcgaaaggaa cagcagagtg 960 ctgtggatgc tgacgatggt cattttgtca gcatagagct ggagtaaaaa actaccttgt 1020 ttctact 1027 //