ID U73498; SV 1; linear; genomic DNA; STD; VRL; 1523 BP. XX AC U73498; XX DT 19-NOV-1996 (Rel. 49, Created) DT 18-APR-2005 (Rel. 83, Last updated, Version 3) XX DE African tomato leaf curl geminivirus Rep protein (AC1) gene, partial cds, DE precoat protein gene, complete cds, and coat protein gene, partial cds. XX KW . XX OS Tomato leaf curl Tanzania virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-1523 RA Chiang B.-T., Nakhla M.K., Maxwell D.P., Schoenfelder M., Green S.K.; RT "A new geminivirus associated with leaf curl disease of tomato in RT Tanzania"; RL Plant Dis. 0:0(1996). XX RN [2] RP 1-1523 RA Chiang B.-T., Nakhla M.K., Maxwell D.P., Schoenfelder M., Green S.K.; RT ; RL Submitted (04-OCT-1996) to the INSDC. RL Plant Pathology, University of Wisconsin, 1630 Linden Drive, Madison, WI RL 53706-1598, USA XX DR MD5; 7bcb0a42694e3cefa16e6b17ea5dd3f0. XX FH Key Location/Qualifiers FH FT source 1..1523 FT /organism="Tomato leaf curl Tanzania virus" FT /strain="Tanzania" FT /isolate="1" FT /mol_type="genomic DNA" FT /clone="pAF1" FT /note="Leaf samples of tomato with yellow mottle, severe FT leaf curl and stunting symptoms were collected in FT Makutupora in Tanzanianin in Oct. 1994 by Dr. L. L. Black" FT /db_xref="taxon:53481" FT CDS complement(<1..692) FT /codon_start=1 FT /gene="AC1" FT /product="Rep protein" FT /function="binds to the origin of replication and nicks the FT viral polarity strand" FT /note="replication-associated protein" FT /db_xref="GOA:Q96620" FT /db_xref="InterPro:IPR001191" FT /db_xref="InterPro:IPR001301" FT /db_xref="InterPro:IPR022690" FT /db_xref="InterPro:IPR022692" FT /db_xref="UniProtKB/TrEMBL:Q96620" FT /protein_id="AAB18229.1" FT /translation="MPPPKRFQINSKNYFLTYPKCSLNKEEALSQLINTDTPTNKKYIK FT ICRELHEDGEPHLHVLIQFEGKFNCKNNRFFDLVSPTRSTHFHPNIQGAKSSSDVKSYI FT DKDGDTLEWGEFQIDGRSARGGCHNANDACAEALNAGSAEAALAIIREKLPKDFIFQYH FT NLKCNLDRIFTPPLEDYVSPFLCSSFDQVPEELEEWAAQNVLTTAARPLRPMSIVIEGD FT SRTGKTMWA" FT misc_feature 690..858 FT /note="origin of replication; common region" FT CDS 981..1325 FT /codon_start=1 FT /product="precoat protein" FT /db_xref="GOA:Q96621" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q96621" FT /protein_id="AAB18231.1" FT /translation="MWDPLVNEFPESVHGFRCMLAIKYLQAVEESYEPNTLGHDLIRDL FT ISVVRARDYVEATRRYNHFHARLEGSSKAELRQPLYQPCCCPHCPRHKQTQVMDVQAHV FT PQAQNVSHVS" FT CDS 1141..>1523 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:Q96622" FT /db_xref="InterPro:IPR000263" FT /db_xref="InterPro:IPR000650" FT /db_xref="UniProtKB/TrEMBL:Q96622" FT /protein_id="AAB18230.1" FT /translation="MSKRPADIIISTPASKVRRRLNFDSPYTSRAAVPIAPGTSKRRSW FT TYRPMYRKPRMYRMFRSPDVPRGCEGPCKVQSYEQRDDVKHTGIVRCVSDVTRGNGITH FT RVGKRFCIKSIYILGKIWMDENI" XX SQ Sequence 1523 BP; 393 A; 314 C; 353 G; 463 T; 0 other; gcccacattg tctttcccgt acgactatcc ccttcaatca caatactcat gggtcttaat 60 ggccgcgcag cggtagttag aacattctgt gccgcccact cttcaagttc ctctggaact 120 tgatcgaaag aagaacataa gaaaggagaa acataatcct ccaacggagg tgtaaaaatc 180 ctatctaaat tacattttaa attatgatac tgaaaaatga aatctttagg gagtttctcc 240 ctaataatag ccagagcggc ttcagcggat cctgcgttta atgcctcggc gcatgcgtcg 300 ttagcattat ggcagcctcc tctagcactt ctgccgtcga tctggaattc cccccattcg 360 agtgtatctc catccttgtc gatgtaggac ttgacgtcgg agcttgattt agctccctga 420 atgttcggat ggaaatgtgt tgacctggtt ggggatacca ggtcgaagaa tctgttattt 480 ttgcagttga attttccctc gaactgaata agcacgtgga gatgaggctc cccatcttcg 540 tgtagttctc tgcaaatttt gatgtatttt ttatttgttg gagtatcagt atttattaat 600 tgagatagtg cttcttcttt atttagagag catttgggat aagtgaggaa ataatttttg 660 gaatttattt ggaaacgctt aggaggaggc atattggtca atgggtaccg attgactcgc 720 ttggaatgct ttctcctggt atatcggtac ccaatatata gtgggtaccg aatggcagta 780 tggtaataac aggaagttac tttatcctta ttgtcaaatt ggtaaagcgg ccatccgtct 840 aatattaccg gatggccggc gcccccgaaa aagccatggg cccctttaac tatacggatc 900 caatcagatt gctgcttgaa agcttagtta attttttttg tctttatata cttggctgtt 960 aagtattacc tgccgtcatt atgtgggatc cgttagtaaa tgagtttccg gagtctgttc 1020 acgggtttcg ttgtatgctt gcaataaaat atttgcaggc cgttgaagag tcttacgagc 1080 ccaatacatt gggccacgat ttaattagag atttaatctc tgtagttaga gcccgtgatt 1140 atgtcgaagc gacccgccga tataatcatt tccacgcccg cctcgaaggt tcgtcgaagg 1200 ctgaacttcg acagccctta taccagccgt gctgctgtcc ccattgcccc aggcacaagc 1260 aaacgcaggt catggacgta caggcccatg taccgcaagc ccagaatgta tcgcatgttt 1320 cgtagtccag atgttcctcg gggatgtgag ggtccctgta aggtccagtc ttatgagcag 1380 agggatgatg tgaagcacac tggtattgtt cgttgtgtta gtgatgtaac tagaggtaat 1440 ggaattactc atagagtagg aaaacgtttc tgcattaagt ccatatacat tttagggaaa 1500 atatggatgg atgaaaatat caa 1523 //