ID U57356; SV 1; linear; mRNA; STD; VRL; 1989 BP. XX AC U57356; XX DT 06-FEB-1997 (Rel. 50, Created) DT 14-NOV-2006 (Rel. 89, Last updated, Version 4) XX DE Sugarcane mosaic virus strain D polyprotein mRNA, partial cds. XX KW . XX OS Sugarcane mosaic virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-1989 RA Mirkov T.E., Yang Z.N.; RT "Sequence and relationships of Sugarcane Mosaic and Sorghum Mosaic Virus RT strains, and development of RT-PCR based RFLPs for strain discrimination"; RL Phytopathology 87:932-939(1997). XX RN [2] RP 1-1989 RA Mirkov T.E.; RT ; RL Submitted (02-MAY-1996) to the INSDC. RL T. Erik Mirkov, Plant Pathology, Texas A&M, 2415 E. Hwy 83, Weslaco, TX RL 78596, USA XX DR MD5; 43abb565086c0c1f37f6101e5a5523e3. XX FH Key Location/Qualifiers FH FT source 1..1989 FT /organism="Sugarcane mosaic virus" FT /strain="D" FT /mol_type="mRNA" FT /db_xref="taxon:12224" FT CDS <1..1758 FT /codon_start=1 FT /product="polyprotein" FT /db_xref="GOA:P89206" FT /db_xref="InterPro:IPR001205" FT /db_xref="InterPro:IPR001592" FT /db_xref="InterPro:IPR007094" FT /db_xref="UniProtKB/TrEMBL:P89206" FT /protein_id="AAB70860.1" FT /translation="CDADGSQFDSSLTPYLINAVLHIRLQFMEEWELGAQMLRNLYTEI FT VYTPIATPDGSIIKKFKGNNSGQPSTVVDNTLMVILAFNYAMLSSGIQDNEIDNCCKMF FT ANGDDLLLAVHPDYEHILDGFQTHFGNLGLNFEFNSRTKEKSNLWFMSTQGIKCEGIYI FT PKLEKERIVAILEWDRSNLPEHRLEAICAAMVEAWGYPDLIHEIRKFYAWLLEMQPFAN FT LAKEGLAPYIAETALRNLYLGSGIKEEEIEKYFKQFAKDLPGYLEDYNEEVFHQAGTVD FT AGAQGGGGNAGTQPPATGAAAQGGAQPPATGAAAQPPAAQPTGGATGGGGAQTGAGGTG FT SVTGGQRDKDVDVGTTGKITVPKLKAMSKKMRLPKAKGKDVLHLDFLLTYKPQQQDISN FT TRATREEFDRWYEAIKKEYEIDDTQMTVVMSGLMVWCIENGCSPNINGSWTMMDGDEQR FT VFPLKPVIENASPTFRQIMHHFSDAAEAYIEYRNSTERYMPRYGLQRNLTDYSLARYAF FT DFYEMNSRTPARAKEAHMQMKAAAVRGSNTRLFGLDGNVGETQENTERHTAGDVSRNMH FT SLLGVQQHH" FT mat_peptide <1..828 FT /product="nuclear inclusion II protein" FT variation 6 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 9 FT /replace="t" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 48 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 60 FT /replace="a" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 108 FT /replace="g" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 121 FT /replace="t" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 297 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 318 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 684 FT /replace="a" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 693 FT /replace="t" FT /note="nucleotide difference between two independent clones FT for this strain" FT mat_peptide 829..1755 FT /product="coat protein" FT variation 891 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 897 FT /replace="g" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 936 FT /replace="a" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 1338 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain" FT 3'UTR 1759..1989 FT variation 1760 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 1837 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain" XX SQ Sequence 1989 BP; 630 A; 413 C; 486 G; 460 T; 0 other; tgtgatgccg atggttcaca atttgacagc tccttaacac catatcttat aaatgccgtg 60 ctacacattc gattacaatt tatggaggag tgggaactag gcgcacaaat gttacgaaat 120 ctgtacactg agatcgtcta cacaccaatt gcaacaccag atggttccat aatcaagaaa 180 tttaaaggaa acaatagtgg ccaaccatca actgtagtcg acaacacgct aatggtcatc 240 ttagcattca attatgcaat gttgtcaagt ggaatacaag acaatgaaat tgacaattgt 300 tgcaaaatgt ttgctaatgg agatgatcta ctgttggcag tacatcccga ttatgaacat 360 atactggatg gctttcagac ccactttgga aatcttggtt taaattttga attcaattca 420 cgaacgaagg aaaaatcgaa cttgtggttc atgtcaacac agggaatcaa gtgtgagggc 480 atttacatac caaaactcga aaaggaaaga atagtcgcca tactcgagtg ggatcgctca 540 aatctgcccg agcaccgttt agaagccatt tgtgcagcaa tggtcgaagc atggggctat 600 ccagatctca tacatgaaat tcggaaattt tatgcatggc ttctggagat gcaaccattt 660 gcaaatctag ccaaagaggg tctggctcca tacattgcag aaacagcgct tcgtaacttg 720 tatctaggtt cagggatcaa ggaagaggaa atcgaaaaat acttcaagca gtttgcaaag 780 gacctccctg ggtatttaga ggactacaac gaagaggttt tccaccaagc tggaacagtc 840 gatgcgggcg ctcaaggagg aggtggaaac gccggaactc agccgccagc aaccggagca 900 gcagctcaag gaggagctca accaccagca actggggcag ctgcgcaacc acctgcggct 960 cagcccacag ggggagctac tggaggaggt ggtgcacaaa caggagctgg tggaactggc 1020 tcagttacag gaggtcagag agacaaggat gtagatgttg gtacgacagg taaaatcaca 1080 gtgccaaaac ttaaagccat gtcgaagaag atgcgcttac caaaagcaaa aggaaaggat 1140 gttttacatc tagactttct gttaacatac aaaccgcaac aacaagacat atcaaacaca 1200 agagcaacca gagaggagtt tgataggtgg tatgaagcca taaagaagga atatgaaata 1260 gatgacacac aaatgacagt tgtcatgagt ggtctaatgg tatggtgtat tgagaatggt 1320 tgctcaccaa acataaatgg aagttggaca atgatggatg gagatgaaca aagagtcttc 1380 ccattgaaac cagttattga aaacgcatct ccaacattcc ggcaaataat gcatcatttc 1440 agtgatgcag ctgaagcata tatcgagtat agaaactcta cagagcgata catgccacga 1500 tatggacttc agcgaaatct caccgactat agcttagcgc ggtatgcatt tgacttttac 1560 gaaatgaatt caaggacacc agctagagct aaggaagccc acatgcagat gaaggccgca 1620 gcagtccgtg gttcaaacac acgattgttc ggtctggacg gaaatgtcgg cgagacccag 1680 gagaatacag agagacacac agctggcgat gtcagtcgca acatgcactc tctgttggga 1740 gtgcagcagc accactagtt tcctggaaac cctgtttgca gtacctatag tatgtactaa 1800 taatgtgtat cagtgaggtt ttacctcgtc tctactatat tacgtatgta cttaaagcgt 1860 gaaccagtct gcaggacaca gggttggacc cagtgtcttc tggtgtagcg tgtactagcg 1920 tcgagccacg tgacggacag cactgagtgt ggctttgcca ttagtgctgc gagtctcttg 1980 gtgagagac 1989 //