ID U57355; SV 1; linear; mRNA; STD; VRL; 1989 BP. XX AC U57355; XX DT 06-FEB-1997 (Rel. 50, Created) DT 14-NOV-2006 (Rel. 89, Last updated, Version 4) XX DE Sugarcane mosaic virus strain B polyprotein mRNA, partial cds. XX KW . XX OS Sugarcane mosaic virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-1989 RA Mirkov T.E., Yang Z.N.; RT "Sequence and relationships of Sugarcane Mosaic and Sorghum Mosaic Virus RT strains, and development of RT-PCR based RFLPs for strain discrimination"; RL Phytopathology 87:932-939(1997). XX RN [2] RP 1-1989 RA Mirkov T.E.; RT ; RL Submitted (02-MAY-1996) to the INSDC. RL T. Erik Mirkov, Plant Pathology, Texas A&M, 2415 E. Hwy 83, Weslaco, TX RL 78596, USA XX DR MD5; 3198eda9eb16b47da4ddf8dac65fd537. XX FH Key Location/Qualifiers FH FT source 1..1989 FT /organism="Sugarcane mosaic virus" FT /strain="B" FT /mol_type="mRNA" FT /db_xref="taxon:12224" FT mat_peptide <1..828 FT /product="nuclear inclusion II protein" FT CDS <1..1758 FT /codon_start=1 FT /product="polyprotein" FT /db_xref="GOA:P89205" FT /db_xref="InterPro:IPR001205" FT /db_xref="InterPro:IPR001592" FT /db_xref="InterPro:IPR007094" FT /db_xref="UniProtKB/TrEMBL:P89205" FT /protein_id="AAB70859.1" FT /translation="CDADGSQFDSSLTPYLINAVLHIRLQFMEEWELGAQMLRNLYTEI FT VYTPIATPDGSIIKKFKGNNSGQPSTVVDNTLMVILAFNYAMLSSGIQDNEIDNCCKMF FT ANGDDLLLAVHPDYEHILDGFQTHFGNLGLNFEFNSRTKEKSNLWFMSTQGLKCEGIYI FT PKLEKERIVAILEWDRSNLPEHRLEAICAAMVEAWGYPDLIHEIRKFYAWLLEMQPFAN FT LAKEGLAPYIAETALRNLYLGSGIKEEEIEKYFKQFAKDLPGYLEDYNEEVFHQAGTVD FT AGAQGGGGNAGTQPPATGAAVQGGAQPPATGAAAQPPAAQPTGGATGGGSAQTGAGGTG FT SITGGQRDKDVDAGTTGKITVPKLKAMSKKMRLPKAKGKDVLHLDFLLTYKPQQQDISN FT TRATREEFDRWYEAIKKEYEIDDTQMTVVMSGLMVWCIENGCSPNINESWTMMDGDEQR FT VFPLKPVIENASPTFRQIMHHFSDAAEAYIEYRNSTERYMPRYGLQRNLTDYSLARYAF FT DFYEMNSRTPARAKEAHMQMKAVAVRGSNTRLFGLDGNVGETQENTERHTAGDVSRNMH FT SLLGVQQHH" FT variation 3 FT /replace="t" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 6 FT /replace="t" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 9 FT /replace="t" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 15 FT /replace="t" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 72 FT /replace="a" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 99 FT /replace="g" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 144 FT /replace="g" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 576 FT /replace="a" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 753 FT /replace="t" FT /note="nucleotide difference between two independent clones FT for this strain" FT mat_peptide 829..1755 FT /product="coat protein" FT variation 905 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain; results in amino acid change from V to A" FT variation 991 FT /replace="g" FT /note="nucleotide difference between two independent clones FT for this strain; results in amino acid change from S to G" FT variation 1340 FT /replace="g" FT /note="nucleotide difference between two independent clones FT for this strain; results in amino acid change from E to G" FT variation 1465 FT /replace="a" FT /note="nucleotide difference between two independent clones FT for this strain; results in amino acid change from E to K" FT variation 1487 FT /replace="a" FT /note="nucleotide difference between two independent clones FT for this strain; results in amino acid change from R to Q" FT variation 1619 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain; results in amino acid change from V to A" FT 3'UTR 1759..1989 FT variation 1942 FT /replace="a" FT /note="nucleotide difference between two independent clones FT for this strain" FT variation 1950 FT /replace="c" FT /note="nucleotide difference between two independent clones FT for this strain" XX SQ Sequence 1989 BP; 633 A; 423 C; 482 G; 451 T; 0 other; tgcgacgcgg atggctcaca atttgacagc tccttaacac catatctcat aaatgccgtg 60 ctacacattc ggttacaatt tatggaggag tgggaattag gcgcacaaat gttacgaaat 120 ctgtacactg agatcgtcta cacaccaatt gcaacaccag atggttccat aatcaagaaa 180 tttaaaggaa acaacagtgg tcaaccatca actgtagtcg acaacacgct aatggtcatc 240 ttagcattca attatgcaat gttgtcaagt ggaatacaag acaatgaaat tgacaactgt 300 tgcaaaatgt ttgctaatgg agatgatcta ctgttggcag tacatcccga ttatgaacat 360 atactggatg gctttcagac ccactttgga aaccttggtt taaattttga attcaattca 420 cgaacgaagg aaaaatcgaa tttgtggttc atgtcaacac agggactcaa gtgtgagggc 480 atttacatac caaaactcga aaaggaaaga atagtcgcca tactcgagtg ggatcgctca 540 aatctacccg agcaccgttt ggaagccatt tgtgcggcaa tggtcgaagc gtggggctat 600 ccagatctca tacatgaaat ccggaaattt tatgcatggc ttctggaaat gcaaccattt 660 gcaaatctag ccaaagaggg tttagctcca tacattgcag aaacagcgct tcgtaacctg 720 tatctaggct cagggatcaa ggaagaggaa atcgaaaaat acttcaagca gtttgcaaag 780 gacctccctg ggtatttaga ggactacaac gaagaagttt tccaccaagc tggaacagtc 840 gatgcaggcg ctcaaggagg aggtggaaac gctggaactc aaccgccagc caccggagca 900 gcagttcaag gaggagctca accaccagca actggagcag ctgcgcaacc acctgcggct 960 cagcccacag ggggagctac tggaggaggt agtgcacaaa caggagctgg tggaactggc 1020 tcaattacag gaggccaaag agacaaggat gtagatgctg gtacgacagg caaaatcaca 1080 gtgccaaaac ttaaagccat gtcgaagaag atgcgcttac caaaagcaaa aggaaaggac 1140 gttttacacc tggactttct gttaacatac aaaccgcaac aacaagacat atcaaacaca 1200 agagcaacca gagaggagtt tgataggtgg tatgaagcca taaagaagga atatgaaata 1260 gatgacacac aaatgacagt tgtcatgagt ggtctaatgg tatggtgtat tgaaaatggt 1320 tgctcaccaa acataaacga aagttggaca atgatggatg gagatgaaca aagagtcttc 1380 ccattgaaac cagttattga aaacgcatct ccaacattcc ggcaaataat gcatcatttc 1440 agtgatgcag ctgaagcata tatcgagtat agaaattcta cagagcgata catgccacga 1500 tatggacttc agcgaaatct caccgactat agcttagcgc ggtatgcatt cgacttttac 1560 gaaatgaatt caagaacacc agctagagct aaggaagccc acatgcagat gaaggccgta 1620 gcagtccgtg gttcaaacac acgattgttc ggtctggacg gaaatgtcgg cgagacccag 1680 gagaatacag agagacacac agctggcgat gtcagtcgta acatgcactc tctgttggga 1740 gtgcagcagc accactagtt tcctggaaac cctgtttgca gtacctatag tatgtactaa 1800 taatgtgtat cagtgaggtt ctacctcgtc tctactatat tacgtatgta cttaaagcgt 1860 gaaccagtct gcaggacaca gggttggacc cagtgtcttc tggtgtagcg tgtactagcg 1920 tcgagccacg tgacggacag cgctgggtgt ggctttgcca ttggtgctgc gagtctcttg 1980 gtgagagac 1989 //