ID U12509; SV 1; linear; mRNA; STD; VRL; 876 BP. XX AC U12509; XX DT 22-AUG-1994 (Rel. 40, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 2) XX DE Alfalfa mosaic virus NZ1 RNA4 coat protein mRNA, complete cds. XX KW . XX OS Alfalfa mosaic virus OC Viruses; Riboviria; Bromoviridae; Alfamovirus. XX RN [1] RP 1-876 RA Bryan G.T., Gardner R.C., Forster R.L.S.; RT "Nucleotide sequence of the coat protein gene of two New Zealand strains of RT Alfalfa Mosaic Virus"; RL Unpublished. XX RN [2] RP 1-876 RA Forster R.L.S.; RT ; RL Submitted (21-JUL-1994) to the INSDC. RL Richard L.S. Forster, HortResearch, Molecular Genetics, 120 Mt Albert Road, RL Auckland, New Zealand XX DR MD5; fc08de0ee91349c7f32ce16c605be91d. DR RFAM; RF00252; Alfamo_CPB. XX FH Key Location/Qualifiers FH FT source 1..876 FT /organism="Alfalfa mosaic virus" FT /host="Medicago sativa" FT /lab_host="Nicotiana clevelandii" FT /strain="NZ1" FT /mol_type="mRNA" FT /note="This sequence was determined from PCR products FT generated using oligos corresponding to bases 1-15 and FT 864-876. The NZ1 RNA4 sequence shown is missing 5 bases at FT the 3' end (gacgc) compared to strain 425" FT /db_xref="taxon:12321" FT CDS 37..702 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:Q65001" FT /db_xref="UniProtKB/TrEMBL:Q65001" FT /protein_id="AAA20650.1" FT /translation="MSSSQKKAGGKAGKSTKRSQNYAALRKAQLPKPPALKVPVAKPTN FT TILPQTGCVWQSLGTPLSLSSFNGLGVRFLYSFLKDFAGPRILEEDLIYRMVFSITPSH FT AGTFCLTDDVTTEDGRAVAHGNPMQEFPHGVFHANEKFGFRLVFTAPTHAGMQNQNFKH FT SYAVALCLDFDAQPEGSKNPSYRFNEVWVERKAFPRAGPLRSLITVGLFDEADYLDRH" XX SQ Sequence 876 BP; 218 A; 205 C; 206 G; 247 T; 0 other; gtttttattt ttaattttct ttcaaatact tccatcatga gttcttcaca aaagaaagct 60 ggtgggaaag ctggtaaatc tactaaacgt tctcagaact atgctgcttt acgcaaagct 120 caactgccga agcctccggc gttgaaagtc ccggttgcaa aaccgacgaa tactatactg 180 ccacagacgg gctgtgtgtg gcaaagcctc gggacccctc tgagtctgag ctcttttaat 240 gggctcggcg tgagattcct ctacagtttt ctgaaggatt tcgcgggacc tcggatcctc 300 gaagaggatc tgatttacag gatggtgttt tctataacac cgtcccatgc cggcaccttt 360 tgtctcactg atgacgtgac gactgaggat ggtagggccg ttgcgcatgg taatcccatg 420 caagaatttc ctcatggcgt gtttcacgct aatgagaagt tcgggtttag attggtcttc 480 acagctccta cccatgcggg aatgcaaaat caaaatttca agcattccta tgccgtagcc 540 ctctgtttgg acttcgatgc gcagcctgag ggatctaaaa atccctcata ccgattcaac 600 gaagtttggg tcgagagaaa ggcgttcccg cgagcagggc ccctccgcag tttgattact 660 gtgggtctgt tcgacgaagc tgactatctt gatcgtcatt gatgtacccc attaatctgg 720 gatgctaaag tcatttaatg ctgacctcca ctgggtggat taaggtcaag gtatgaagtc 780 ctattcgctc ctgataggaa cgacttcata ttgcttatat atgtgctaac gaacatatat 840 aaatgctcat gcaaaactgc atgaatgccc ctaagg 876 //