ID M20356; SV 1; linear; genomic RNA; STD; VRL; 336 BP. XX AC M20356; XX DT 20-FEB-1989 (Rel. 18, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 2) XX DE Cucumber mosaic virus CARNA 5 gene with ORFs I, IIA, and IIB, 5' end, clone DE X12. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-336 RX DOI; 10.1016/0042-6822(88)90268-1. RX PUBMED; 3354198. RA Kaper J.M., Tousignant M.E., Steen M.T.; RT "Cucumber mosaic virus-associated RNA 5. XI. Comparison of 14 CARNA 5 RT variants relates ability to induce tomato necrosis to a conserved RT nucleotide sequence"; RL Virology 163(2):284-292(1988). XX DR MD5; 7c3a467aa38f82be892e50657340fab0. XX FH Key Location/Qualifiers FH FT source 1..336 FT /organism="Cucumber mosaic virus" FT /mol_type="genomic RNA" FT /db_xref="taxon:12305" FT CDS 11..94 FT /codon_start=1 FT /note="ORF I" FT /db_xref="UniProtKB/TrEMBL:Q89492" FT /protein_id="AAA46400.1" FT /translation="MENCAEGLYLREDLSLGGVGYLPAKAG" FT CDS 98..169 FT /codon_start=1 FT /note="ORF IIA" FT /db_xref="UniProtKB/TrEMBL:Q66265" FT /protein_id="AAA46401.1" FT /translation="MFPRTGDRWLASHVRYSQYYTLI" FT CDS 135..248 FT /codon_start=1 FT /note="ORF IIB" FT /db_xref="InterPro:IPR009536" FT /db_xref="UniProtKB/TrEMBL:Q89781" FT /protein_id="AAA46402.1" FT /translation="MSATLSTTLSFEPPLSLLAEPGTWFADTMDFSKETLC" XX SQ Sequence 336 BP; 66 A; 82 C; 96 G; 92 T; 0 other; gttttgtttg atggagaatt gcgcagaggg gttatatctg cgtgaggatc tgtcactcgg 60 cggtgtggga tacctccctg ctaaggcggg ttgagtgatg ttccctcgga ctggggaccg 120 ctggcttgcg agtcatgtcc gctactctca gtactacact ctcatttgag cccccgctca 180 gtttgctagc agaacccggc acatggttcg ccgataccat ggatttttcg aaagaaacac 240 tctgttaggt ggtatgagtc atgacgcacg cagggagagg ctaaggctta tgctatgctg 300 atctccgtga atgtctatca ttcctctgca ggaccc 336 //