ID M20352; SV 1; linear; genomic RNA; STD; VRL; 335 BP. XX AC M20352; XX DT 20-FEB-1989 (Rel. 18, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 2) XX DE Cucumber mosaic virus CARNA 5 gene with ORFs I, IIA, and IIB, 5' end, clone DE Sq10. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-335 RX DOI; 10.1016/0042-6822(88)90268-1. RX PUBMED; 3354198. RA Kaper J.M., Tousignant M.E., Steen M.T.; RT "Cucumber mosaic virus-associated RNA 5. XI. Comparison of 14 CARNA 5 RT variants relates ability to induce tomato necrosis to a conserved RT nucleotide sequence"; RL Virology 163(2):284-292(1988). XX DR MD5; 02e403339dce9c0df6ecbbe9ae3671cd. XX FH Key Location/Qualifiers FH FT source 1..335 FT /organism="Cucumber mosaic virus" FT /mol_type="genomic RNA" FT /db_xref="taxon:12305" FT CDS 11..94 FT /codon_start=1 FT /note="ORF I" FT /db_xref="UniProtKB/TrEMBL:Q89492" FT /protein_id="AAA46388.1" FT /translation="MENCAEGLYLREDLSLGGVGYLPAKAG" FT CDS 98..169 FT /codon_start=1 FT /note="ORF IIA" FT /db_xref="UniProtKB/TrEMBL:Q89720" FT /protein_id="AAA46389.1" FT /translation="MLPRTGDRWLASYVRYSQYYTLI" FT CDS 135..263 FT /codon_start=1 FT /note="ORF IIB" FT /db_xref="InterPro:IPR009536" FT /db_xref="UniProtKB/TrEMBL:Q89599" FT /protein_id="AAA46390.1" FT /translation="MSATLSTTLSFEPPLSLLAEPGTWFADTMDFRKKHSVRWYES" XX SQ Sequence 335 BP; 70 A; 82 C; 94 G; 89 T; 0 other; gttttgtttg atggagaatt gcgcagaggg gttatatctg cgtgaggatc tgtcactcgg 60 cggtgtggga tacctccctg ctaaggcggg ttgagtgatg ctccctcgga ctggggaccg 120 ctggcttgcg agctatgtcc gctactctca gtactacact ctcatttgag cccccgctca 180 gtttgctagc agaacccggc acatggttcg ccgataccat ggattttcga aagaaacact 240 ctgttaggtg gtatgagtca tgacgcacac agggagaggc taaggcttat gctatgctga 300 tctccgtgaa tgtctaacat tccattacag gaccc 335 //