ID KC996726; SV 1; linear; genomic RNA; STD; VRL; 717 BP. XX AC KC996726; XX DT 13-JUN-2013 (Rel. 117, Created) DT 13-JUN-2013 (Rel. 117, Last updated, Version 1) XX DE Tobacco streak virus isolate Jasmine-TSV-Kadapa coat protein (CP) gene, DE complete cds. XX KW . XX OS Tobacco streak virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RP 1-717 RA Seshadri Goud T.E., Vemana K., Md khureshi C.S., Padma J.G., Shabeer S., RA Reddy D.L.; RT "First report of Tobacco streak virus infecting Jasminum sambac in India"; RL Unpublished. XX RN [2] RP 1-717 RA Seshadri Goud T.E., Vemana K., Md khureshi C.S., Padma J.G., Shabeer S., RA Reddy D.L.; RT ; RL Submitted (30-APR-2013) to the INSDC. RL Plant Pathology, Acharya NG Ranga Agricultural University, Agricultural RL Research Station, Kadiri, Andhra Pradesh 515591, India XX DR MD5; df06f107f195eda3cdfe3351424f6881. DR EuropePMC; PMC4188202; 25674611. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..717 FT /organism="Tobacco streak virus" FT /host="Jasminum sambac" FT /isolate="Jasmine-TSV-Kadapa" FT /mol_type="genomic RNA" FT /country="India" FT /isolation_source="infected leaf" FT /collection_date="15-Jul-2012" FT /db_xref="taxon:12317" FT gene 1..717 FT /gene="CP" FT CDS 1..717 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:R9UTJ8" FT /db_xref="InterPro:IPR002681" FT /db_xref="InterPro:IPR016405" FT /db_xref="UniProtKB/TrEMBL:R9UTJ8" FT /protein_id="AGN74799.1" FT /translation="MNTLIQGPDHPSNAMSSRTNNRFNNNSSCPTCFDELDAVARGCPA FT HAPANTVSRRQRRNAARAAAFRNANARMTAPIPVVPVSRPQAKTSLKLPNNQVWVTRKA FT SEWSAKTIDTNDAIPFKTIVEGIPEINSETKFYRLLIGFVAVSDGTFGMVDGVTGDVIP FT DPPVVGRLGFTKNTYRSRDFDLGGKLLNQLDDRAIVWCLDERRRDAKRVQLAGYWIAIS FT KPAPLMPPEDFLVNQD" XX SQ Sequence 717 BP; 174 A; 190 C; 187 G; 166 T; 0 other; atgaatactt tgatccaagg tccggaccat ccatccaacg ccatgtcttc ccgtactaac 60 aaccgcttta acaacaacag cagttgccca acttgtttcg acgagttgga tgcagtagcg 120 aggggttgcc ccgctcacgc tcccgcgaac actgtttcgc gacgtcagcg gcgaaatgcc 180 gctagagctg ccgcgtttag gaacgcgaat gctcgaatga ccgcaccaat tcctgtggtg 240 ccggtttccc gccctcaagc gaagacatcg ttgaagctac ccaacaatca agtttgggta 300 actcgcaaag cgagtgaatg gtctgcaaag accattgata ccaacgatgc tatccccttc 360 aagaccatag tcgaggggat tcccgaaatc aattcggaga cgaagtttta ccgtctccta 420 attggttttg tcgccgtctc tgatgggacg tttgggatgg ttgatggagt gacgggagat 480 gtcattccgg acccaccggt cgttggacgg ttgggtttca cgaagaatac ctaccgcagc 540 cgagattttg atctcggcgg taagcttctc aaccaactag acgatagagc tatcgtctgg 600 tgcctcgacg aaaggcgtcg agatgccaag agggttcagc tggcgggata ttggattgcc 660 atatccaaac cagctccctt gatgccaccg gaagatttcc tggtgaatca agactga 717 //