ID   KC841814; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC841814;
XX
DT   29-MAY-2013 (Rel. 116, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate SY568 coat protein (CP) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; Riboviria; Closteroviridae; Closterovirus.
XX
RN   [1]
RP   1-672
RX   DOI; 10.3389/fmicb.2013.00366.
RX   PUBMED; 24339822.
RA   Wang J., Bozan O., Kwon S.-J., Dang T., Rucker T., Yokomi R.K., Lee R.F.,
RA   Folimonova S.Y., Krueger R.R., Bash J., Greer G., Diaz J., Serna R.,
RA   Vidalakis G.;
RT   "Past and future of a century old Citrus tristeza virus collection: a
RT   California citrus germplasm tale";
RL   Front Microbiol. 4:366-366(2013).
XX
RN   [2]
RP   1-672
RA   Wang J., Bozan O., Kwon S.-J., Dang T., Rucker T.L., Yokomi R.K., Lee R.K.,
RA   Folimonova S.Y., Krueger R.R., Bash J.A., Greer G.D., Diaz J.M.,
RA   Serna R.S., Vidalakis G.;
RT   ;
RL   Submitted (28-MAR-2013) to the INSDC.
RL   Department of Plant Pathology and Microbiology, University of California,
RL   Riverside, 900 University Ave., Riverside, CA 92521, USA
XX
DR   MD5; fdc3eccc73b46100e7774bd699c4a62e.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: DNA Dragon v. 1.5.3
CC   Assembly Name         :: CTV-CP
CC   Coverage              :: 3
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..672
FT                   /organism="Citrus tristeza virus"
FT                   /lab_host="Citrus sinensis"
FT                   /isolate="SY568"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Riverside, California"
FT                   /isolation_source="originally from a stunted and pitted
FT                   Minneola Tangelo tree in Riverside Citrus Research Center
FT                   and Agricultural Experiment Station (CRC 3340). The CRC
FT                   3340 was received as budwood from USDA station at Indio,
FT                   California in 1961. The introduction to Indio was from a
FT                   seedling tree from the USDA station at Weslaco, Texas in
FT                   1959"
FT                   /collected_by="Edmond C. Calavan and Chester Roistacher"
FT                   /collection_date="1978"
FT                   /PCR_primers="fwd_name: CP-U-F-16054-16075, fwd_seq:
FT                   cwtgagcrctgctttaagggtc, rev_name: CP-U-R-16836-16814,
FT                   rev_seq: gatgaaactccaccatcccgata"
FT                   /note="SY568 is maintained in planta at the Citrus Clonal
FT                   Protection Program (CCPP), University of California,
FT                   Riverside The SY568 is the most severe reacting CTV
FT                   seedling yellows and stem pitting isolate in the CCPP
FT                   collection that has been extensively used in many
FT                   experiments and it was first reported by Calavan et al.
FT                   1980. Natural Spread of Seedling Yellows and Sweet Orange
FT                   and Grapefruit Stem Pitting Tristeza Viruses at the
FT                   University of California, Riverside. Proceedings of the 8th
FT                   IOCV, pg.: 69-75. acronym: CTV; genotype: T30+VT"
FT                   /db_xref="taxon:12162"
FT   gene            1..672
FT                   /gene="CP"
FT   CDS             1..672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="major coat protein"
FT                   /db_xref="GOA:O10474"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:O10474"
FT                   /protein_id="AGM39411.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 124 C; 177 G; 180 T; 0 other;
     atggacgacg agacaaagaa attgaagaac aaaaacaagg aaacgaaaga aggcgacgat        60
     gttgttgcag cggagtcttc tttcggttcc ttaaacttac acatcgatcc gactctgata       120
     gcgatgaacg acgtgcgtca gttaggtacc caacagaatg ccgctttgaa cagagatttg       180
     ttccttactt tgaaagggaa gtatcctaat ttgtctgata aagataagga ctttcacata       240
     gctatgatgt tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacacc       300
     acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa actttggact       360
     gacgtcgtgt tcaattctaa gggtatcggt aaccgtacta acgcccttcg agtctggggt       420
     agaagtaacg atgcccttta tttagcgttt tgtagacaga atcgcaattt gagttatggc       480
     ggacgtccgc tagatgcagg gattccggcc gggtatcatt acctgtgtgc agatttcttg       540
     accggagctg gcttgactga tttggaatgt gctgtgtaca tacaagctaa agaacaattg       600
     ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct tgggaaattt       660
     aacacacgtt ga                                                           672
//