ID KC577425; SV 1; linear; genomic RNA; STD; VRL; 231 BP. XX AC KC577425; XX DT 15-MAY-2013 (Rel. 116, Created) DT 15-MAY-2013 (Rel. 116, Last updated, Version 1) XX DE Potato virus Y isolate CS13 PIPO gene, partial cds. XX KW . XX OS Potato virus Y OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-231 RA Gao F.L., Zhan J.S., Xie L.H.; RT "Molecular characterization of pipo gene of Potato Virus Y"; RL Unpublished. XX RN [2] RP 1-231 RA Gao F.L., Zhan J.S., Xie L.H.; RT ; RL Submitted (05-FEB-2013) to the INSDC. RL Plant Protection, Plant Virology, Kingshan, Fuzhou, Fujian 350002, P.R. RL China XX DR MD5; 4d84b6901d0717319247e3df982f472d. XX FH Key Location/Qualifiers FH FT source 1..231 FT /organism="Potato virus Y" FT /host="Solanum tuberosum" FT /isolate="CS13" FT /mol_type="genomic RNA" FT /country="China:Hunan" FT /collection_date="21-Apr-2011" FT /db_xref="taxon:12216" FT CDS <4..231 FT /codon_start=1 FT /product="PIPO" FT /db_xref="UniProtKB/TrEMBL:R4ND58" FT /protein_id="AGL43539.1" FT /translation="KKLSKSLGRCLERFNLAGKIIRNMVLIQSKTLYHSVHKTHRKGRF FT ERVIQHITTSILGPKRPSGQRYCLRIERAI" XX SQ Sequence 231 BP; 79 A; 48 C; 53 G; 51 T; 0 other; ggaaaaaaat tatctaaatc tcttggacga tgcttggaaa gatttaactt ggcgggaaaa 60 attatccgca acatggtact catacagagc aaaacgctct atcactcggt acataaaacc 120 cacaggaagg gcagatttga gagggttata caacatatca ccacaagcat tcttgggccg 180 aagcgcccaa gtggtcaaag gtactgcctc aggattgagc gagcgattta a 231 //