ID KC161369; SV 1; linear; genomic RNA; STD; VRL; 822 BP. XX AC KC161369; XX DT 13-FEB-2013 (Rel. 115, Created) DT 23-DEC-2015 (Rel. 127, Last updated, Version 2) XX DE Iris yellow spot virus isolate 2 nucleocapsid protein (NP) gene, complete DE cds. XX KW . XX OS Iris yellow spot virus OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Ellioviricetes; OC Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-822 RX DOI; 10.1007/s13337-014-0235-7. RX PUBMED; 25674622. RA Hafez E.E., El-Morsi A.A., El-Shahaby O.A., Abdelkhalek A.A.; RT "Occurrence of iris yellow spot virus from onion crops in Egypt"; RL Virusdisease 25(4):455-459(2014). XX RN [2] RP 1-822 RA Abdelkhalek A.A., Hafez E.E.; RT ; RL Submitted (13-NOV-2012) to the INSDC. RL Molecular Plant Pathology, City of Scientific Research and Technological RL Applications, New Borg Alarab, Alexandria, Egypt XX DR MD5; 5e80cf436da702b873ce8dbe28c6db90. DR EuropePMC; PMC4262308; 25674622. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..822 FT /organism="Iris yellow spot virus" FT /host="onion" FT /isolate="2" FT /mol_type="genomic RNA" FT /country="Egypt" FT /collection_date="2012" FT /db_xref="taxon:60456" FT gene 1..822 FT /gene="NP" FT CDS 1..822 FT /codon_start=1 FT /gene="NP" FT /product="nucleocapsid protein" FT /db_xref="GOA:M1J802" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:M1J802" FT /protein_id="AGE83532.1" FT /translation="MSTVRVKPSEIEKLLSGGDVDVVIESDETEGFNFKNFVLANEGVQ FT MSFNNGYTILRNRAGIYKTIKSGKFTFQGKTIVIPSACVMPNQDDWTFRRLEGFIRARM FT LVELLETKDEKEKQKMYEKICGLPLVSAYGLKPSSKFDATTAKIMLTLGGPLTLLASLD FT IFAATALPLCYFQWVKKEALGISRFSTYEQLCKVARVMAAKEFKFTEKYKKVFDETVKI FT LTDCTPGTSGAASLIKFNEQIKILEGAFGKIVEDIGESSKPKNPSKKDRYN" XX SQ Sequence 822 BP; 266 A; 147 C; 185 G; 224 T; 0 other; atgtctaccg ttagggtgaa accgtcagaa atcgagaaac ttctgtctgg cggagatgtg 60 gatgtggtta ttgaatcgga tgagactgaa ggattcaatt tcaagaattt tgtgttggca 120 aacgaaggtg tccaaatgtc attcaacaat ggctacacaa ttcttagaaa cagagcaggc 180 atttacaaga caattaaatc agggaaattc acattccaag gaaagaccat tgttattcct 240 agtgcttgtg ttatgcccaa tcaagacgat tggacattca ggaggttgga aggcttcatc 300 agagccagaa tgctcgtaga actgctggaa acaaaggatg aaaaagaaaa gcagaaaatg 360 tatgaaaaga tttgcgggct tcctctggtg tcggcatatg gtttgaagcc tagttccaag 420 tttgatgcaa ctactgctaa gatcatgctg acactaggtg gtcctctcac attgctggca 480 agtcttgaca tcttcgctgc aactgctctt cctttgtgct atttccaatg ggtaaaaaag 540 gaagcactcg gtataagcag attctcaact tatgagcaac tctgtaaagt tgcaagagtc 600 atggcagcaa aggaattcaa attcacagag aaatacaaaa aggtttttga tgaaactgta 660 aagattctta ctgactgcac tcctggaact tcgggtgctg cttcattgat caaattcaat 720 gaacagatta aaattcttga aggtgctttt ggaaagattg ttgaagacat tggtgagtct 780 tctaaaccca aaaatccctc taagaaagac agatataact ag 822 //