ID KC136838; SV 1; linear; genomic RNA; STD; VRL; 878 BP. XX AC KC136838; XX DT 16-DEC-2012 (Rel. 115, Created) DT 13-JUN-2014 (Rel. 121, Last updated, Version 2) XX DE Cherry necrotic rusty mottle virus isolate IV-20 coat protein gene, DE complete cds. XX KW . XX OS Cherry necrotic rusty mottle virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; OC Robigovirus. XX RN [1] RP 1-878 RX DOI; 10.1016/j.mcp.2014.03.002. RX PUBMED; 24675146. RA Komorowska B., Fiore N., Zamorano A., Li R.; RT "Simultaneous detection of Cherry necrotic rusty mottle virus and Cherry RT green ring mottle virus using real-time PCR and high resolution melting RT analysis"; RL Mol. Cell. Probes 28(4):186-191(2014). XX RN [2] RP 1-878 RA Komorowska B.; RT ; RL Submitted (06-NOV-2012) to the INSDC. RL Plant Protection, Research Institute of Pomology and Floriculture, RL Pomologiczna 18, Skierniewice, Lodzkie 96-100, Poland XX DR MD5; 77aaec9cf448b12c4503bee0517294f9. XX CC ##Assembly-Data-START## CC Assembly Method :: Lasergene v. 7 CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..878 FT /organism="Cherry necrotic rusty mottle virus" FT /host="sweet cherry" FT /isolate="IV-20" FT /mol_type="genomic RNA" FT /country="Poland" FT /collection_date="20-May-2010" FT /db_xref="taxon:129143" FT CDS 55..858 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:L0AU29" FT /db_xref="InterPro:IPR000052" FT /db_xref="UniProtKB/TrEMBL:L0AU29" FT /protein_id="AFZ78452.1" FT /translation="MADEYELNDDGTFKLDAANNKIPKKKATGPPPPPPRNEESPSRKS FT DIDILRSRRRRVNFDPKNPTSSPSREFINNIQEKDPTTLNIASDDTVKAIAADWVEHLK FT VPESETFNCIFDVVWYCYHNSSSDKTKFVGRAKCNVDLEELASTIRSYCSLRSFCSKYA FT PVIWDFAISNDIPPANWQRRKVIEGAKFAAFDFFEAVTSAAALQPVAGLVRNPTDKEMI FT AGASLKEISLMRDEIRRGTSSTLMTEVTGGRTGQVQPIKRIGGDE" XX SQ Sequence 878 BP; 270 A; 189 C; 206 G; 213 T; 0 other; gcactctaat ttgaatatca tttgagtgtg tgtgagcttt caagttcatt taagatggca 60 gatgagtatg agctgaatga cgatggaacc ttcaaactcg acgctgcaaa taacaagatc 120 ccgaagaaga aggcgactgg gccgccccct ccacctccca gaaatgaaga aagcccttca 180 agaaagagcg acattgacat cctcaggtca agaagaaggc gggtcaattt tgatcccaaa 240 aatcccacct caagtcctag cagagagttt atcaacaaca ttcaagagaa ggaccctaca 300 actctcaaca ttgcatctga tgacacagtt aaagcaattg cagccgattg ggttgagcac 360 ctcaaggtgc ccgagtctga aacattcaat tgcatttttg atgttgtctg gtactgctac 420 cacaacagtt caagtgacaa aaccaaattc gttggcagag ccaagtgcaa cgttgacctt 480 gaggaactgg cgagcactat taggagctac tgttctttgc gtagcttttg ctcaaaatat 540 gcgccagtaa tttgggattt tgcaattagc aatgatatac ctccagctaa ttggcaaaga 600 aggaaggtca ttgaaggagc gaagttcgca gcttttgatt tctttgaggc tgtaaccagt 660 gcagcagctt tgcaacctgt tgctgggctt gtcagaaatc caacagacaa agagatgatt 720 gccggtgcat ctctaaaaga aataagttta atgagagatg agattcgcag ggggacgagc 780 tcaactctga tgactgaagt gactggcggc agaactggcc aagttcaacc catcaagcgt 840 attggtggtg atgaatgata aacctctgca aacccaat 878 //