ID K01138; SV 1; linear; genomic RNA; STD; VRL; 751 BP. XX AC K01138; XX DT 13-JUN-1985 (Rel. 06, Created) DT 05-NOV-2005 (Rel. 85, Last updated, Version 4) XX DE Simian rotavirus A/SA11 segment 10, complete sequence. XX KW . XX OS Simian rotavirus A/SA11 OC Viruses; Riboviria; Reoviridae; Sedoreovirinae; Rotavirus; Rotavirus A. XX RN [1] RP 1-751 RX PUBMED; 6312090. RA Both G.W., Siegman L.J., Bellamy A.R., Atkinson P.H.; RT "Coding assignment and nucleotide sequence of simian rotavirus SA11 gene RT segment 10: location of glycosylation sites suggests that the signal RT peptide is not cleaved"; RL J. Virol. 48(2):335-339(1983). XX RN [2] RP 1-751 RA Mitchell D.B., Both G.W.; RT "Complete nucleotide sequence of Simian rotavirus"; RL Unpublished. XX RN [3] RP 1-751 RA Both G.W., Siegman L.J., Bellamy A.R., Atkinson P.H.; RT ; RL Submitted (03-AUG-1993) to the INSDC. RL Mathematical and Information Sciences, Commonwealth Scientific and RL Industrial Research Organisation (CSIRO), Locked Bag 17, North Ryde, NSW RL 1670, Australia XX DR MD5; 45132a9f629ba3c5456b2bafed8d7c38. DR EuropePMC; PMC87623; 11101582. XX FH Key Location/Qualifiers FH FT source 1..751 FT /organism="Simian rotavirus A/SA11" FT /segment="10" FT /strain="SA11" FT /mol_type="genomic RNA" FT /db_xref="taxon:10923" FT CDS 42..569 FT /codon_start=1 FT /product="NCVP5 nonstructural glycoprotein" FT /note="contains signal sequence that is not cleaved during FT membrane translocation" FT /db_xref="GOA:P04512" FT /db_xref="InterPro:IPR002107" FT /db_xref="PDB:1G1I" FT /db_xref="PDB:1G1J" FT /db_xref="PDB:2O1K" FT /db_xref="UniProtKB/Swiss-Prot:P04512" FT /protein_id="AAA47291.1" FT /translation="MEKLTDLNYTLSVITLMNNTLHTILEDPGMAYFPYIASVLTGLFA FT LNKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVK FT EMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGK FT NPYEPREVTAAM" FT misc_feature 63..71 FT /note="potential; glycosylation site" FT misc_feature 93..101 FT /note="potential; glycosylation site" XX SQ Sequence 751 BP; 268 A; 131 C; 171 G; 181 T; 0 other; gggttttaaa agttctgttc cgagagagcg cgtgcggaaa gatggaaaag cttaccgacc 60 tcaattatac attgagtgta atcactctaa tgaacaatac attgcacaca atacttgagg 120 atccaggaat ggcgtatttt ccttatatag catctgtctt aacaggtttg tttgcgctaa 180 ataaagcatc cattccaaca atgaaaattg cattgaaaac gtcaaaatgt tcatataaag 240 tggtgaaata ttgtattgta acaattttta atacgttgtt aaaattggca ggttataaag 300 agcagataac tactaaagat gagatagaaa agcaaatgga cagagtagtc aaagaaatga 360 gacgccagct agaaatgatt gacaaattga ctacacgtga aattgaacaa gtagagttgc 420 ttaaacgcat ttacgataaa ttgacggtgc aaacgacagg cgaaatagat atgacaaaag 480 agatcaatca aaaaaacgtg agaacgctag aagaatggga aagtggaaaa aatccttatg 540 aaccaagaga agtgactgca gcaatgtaag aggttgagct gccgtcgact gtcctcggaa 600 gcggcggagt tctttacagt aagcaccatc ggacctgatg gctgactgag aagccacagt 660 cagccatatc gcgtgtggct caagccttaa tcccgtttaa ccaatccggt cagcaccgga 720 cgttaatgga aggaacggtc ttaatgtgac c 751 //