ID JX982327; SV 1; linear; genomic RNA; STD; VRL; 567 BP. XX AC JX982327; XX DT 12-MAY-2013 (Rel. 116, Created) DT 12-MAY-2013 (Rel. 116, Last updated, Version 1) XX DE Andean potato latent virus isolate Col-4 coat protein gene, complete cds. XX KW . XX OS Andean potato latent virus OC Viruses; Riboviria; Tymovirales; Tymoviridae; Tymovirus. XX RN [1] RP 1-567 RX DOI; 10.1016/j.virusres.2013.01.014. RX PUBMED; 23357297. RA Kreuze J., Koenig R., De Souza J., Vetten H.J., Muller G., Flores B., RA Ziebell H., Cuellar W.; RT "The complete genome sequences of a Peruvian and a Colombian isolate of RT Andean potato latent virus and partial sequences of further isolates RT suggest the existence of two distinct potato-infecting tymovirus species"; RL Virus Res. 173(2):431-435(2013). XX RN [2] RP 1-567 RA Koenig R.; RT ; RL Submitted (17-OCT-2012) to the INSDC. RL Institute for Epidemiology and Pathogen Diagnostics, Julius Kuhn Institute, RL Messeweg 11, Braunschweig D38104, Germany XX DR MD5; d2ed83059d852e21379d520d3f225fd4. XX FH Key Location/Qualifiers FH FT source 1..567 FT /organism="Andean potato latent virus" FT /isolate="Col-4" FT /mol_type="genomic RNA" FT /db_xref="taxon:73819" FT CDS 1..567 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:R4L6J4" FT /db_xref="InterPro:IPR000574" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:R4L6J4" FT /protein_id="AGL11966.1" FT /translation="MATPITTVSKQPSIDAPGHILSTPSSELSPSMVLPFQFTATTFGM FT AETAAQITLVSSTVINKLMLSYRHCQLVECSAELTPFAGAVSNPLSVNLVWVSANSTGT FT PIDILNIYGGSSFVLGGPITASTPISVPLPSNSTNVVLKDSTIYTDTPKLLAYSPNPAN FT PSKTPTASLQIRGKLRLSSPLLQPN" XX SQ Sequence 567 BP; 122 A; 220 C; 80 G; 145 T; 0 other; atggctactc caatcaccac tgtctcaaag caaccctcaa ttgatgctcc aggacacatt 60 ctctctactc cctcatctga gctttccccg tcaatggttc ttcccttcca gttcacagcc 120 accacttttg gcatggctga aactgccgct cagatcactc ttgtctcctc aactgtgatc 180 aacaaactca tgctctccta ccgccattgc cagctcgtcg agtgttctgc ggaactcacc 240 ccttttgctg gcgctgtatc caacccactc tctgtcaacc ttgtctgggt ctccgccaac 300 tccacaggca cccccattga catcctcaac atctacggtg gctcttcctt tgtgctcgga 360 gggcctataa ccgcatcaac tcccatctca gtccctctcc cctccaactc tacaaatgtt 420 gtcctgaaag acagcaccat ttacactgac acccccaagc tgctagctta ctcccccaat 480 ccagctaacc cctccaaaac accaaccgcc tctctccaaa tccgcggcaa actccgtctt 540 tcctctcctc ttctccaacc caactag 567 //