ID JX961595; SV 1; linear; genomic RNA; STD; VRL; 720 BP. XX AC JX961595; XX DT 16-DEC-2012 (Rel. 115, Created) DT 16-DEC-2012 (Rel. 115, Last updated, Version 1) XX DE Rice yellow mottle virus isolate Mg165 coat protein (CP) gene, complete DE cds. XX KW . XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RC Publication Status: Available-Online prior to print RP 1-720 RX PUBMED; 23123216. RA Rakotomalala M., Pinel-Galzi A., Mpunami A., Randrianasolo A., RA Ramavovololona P., Rabenantoandro Y., Fargette D.; RT "Rice yellow mottle virus in Madagascar and in the Zanzibar Archipelago; RT Island systems and evolutionary time scale to study virus emergence"; RL Virus Res. 0:0(2012). XX RN [2] RP 1-720 RA Rakotomalala M., Pinel-Galzi A., Mpunami A., Randrianasolo A., RA Ramavovololona P., Rabenantoandro Y., Fargette D.; RT ; RL Submitted (11-OCT-2012) to the INSDC. RL RPB, IRD, 911 av Agropolis BP 64501, Monptellier 34080, France XX DR MD5; 33cc69fe91cae9d4e7e0f80cfb907442. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /host="Oryza sativa" FT /isolate="Mg165" FT /mol_type="genomic RNA" FT /country="Madagascar" FT /collection_date="2010" FT /db_xref="taxon:31744" FT gene 1..720 FT /gene="CP" FT CDS 1..720 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:L0AQI1" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:L0AQI1" FT /protein_id="AFZ75378.1" FT /translation="MARKGKKINSNQGQQGKKESRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNAWPVHSVEFLMDFKRSATSADAVAFNCVPFNLPRVWSLARCYSLWKPTRW FT DVVYLPEVSAATAGSIEMCYLYDYADAIPSDTGKMSRTAGFVTSSVWYGAEGCHLLNGG FT SARNAVVASMDCSRVGWRRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVDDVPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 151 A; 189 C; 222 G; 158 T; 0 other; atggccagga agggcaagaa aatcaactcc aaccaaggcc agcaaggcaa gaaggagagc 60 cgacgtcctc gtgggcgttc ggcggagccc cagcttcaac gggctccagt ggctcaggcg 120 tcccggatat ctgggacggt tcctggacca ctatcttcta atgcctggcc ggtccactcc 180 gtggaattcc tgatggattt taagcggagt gccacatcgg cggatgcggt ggcatttaat 240 tgcgtgccgt tcaatctgcc tcgggtgtgg agtcttgcac gttgttactc gctgtggaag 300 ccaacacggt gggatgtagt ttacctcccc gaggtgagcg cagcgacggc tggaagtatc 360 gagatgtgtt atctctacga ctacgccgat gctatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctctagcgtt tggtacggcg cggagggctg ccatttgttg 480 aatggcggtt cagcacggaa tgccgtggtc gcctcgatgg attgctctcg agtcggctgg 540 agacgcgtga ctagttcaat tcctagtagc gtggatccca acgtcgtaaa caccatactg 600 ccagcaaggc tagctgtgcg gtcgtcaatc aaaccgacgg tcgatgatgt gccggggaaa 660 ctctatgcca tcgtcagtat ggtcctgcgg gatccggttg atccaacact caatacgtga 720 //