ID JX888092; SV 1; linear; genomic RNA; STD; VRL; 336 BP. XX AC JX888092; XX DT 12-NOV-2012 (Rel. 114, Created) DT 12-NOV-2012 (Rel. 114, Last updated, Version 1) XX DE Cucumber mosaic virus isolate Gerbera 2b protein gene, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-336 RA Gautam K.K., Kumar S., Raj S.K.; RT "Molecular identification of Cucumber mosaic virus associated with mosaic RT disease of Gerbera in India"; RL Unpublished. XX RN [2] RP 1-336 RA Gautam K.K., Kumar S., Raj S.K.; RT ; RL Submitted (01-OCT-2012) to the INSDC. RL Plant Molecular Virology, CSIR-National Botanical Research Institute, RL Lucknow-226001, Rana Pratap Marg, Lucknow, U. P. 226001, India XX DR MD5; ee148bf4123067c956c0bf380754e0e5. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..336 FT /organism="Cucumber mosaic virus" FT /host="Gerbera jamesonii cv. Zingaroo" FT /lab_host="Nicotiana tabacum cv. White Burley" FT /isolate="Gerbera" FT /mol_type="genomic RNA" FT /country="India" FT /collection_date="22-Dec-2010" FT /identified_by="K K Gautam" FT /note="subgroup: IB" FT /db_xref="taxon:12305" FT CDS 1..336 FT /codon_start=1 FT /product="2b protein" FT /note="host silencing suppression and movement of virus" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:K7SHR1" FT /protein_id="AFV99521.1" FT /translation="MELNAGAMTNVELQLAHMMEVRRRRRKSHKKNRRERGHKSPSERA FT RSNLRLFRFLPFYQIDGSELIEMHHHASVVELSESEAPRYALPAEEDHDFDDTDWFAGN FT EWAEGSF" XX SQ Sequence 336 BP; 97 A; 69 C; 99 G; 71 T; 0 other; atggaattga acgcaggcgc aatgacaaac gtcgaactcc agctggctca tatgatggag 60 gtgaggagac gaagacgaaa gtctcacaag aagaatcgac gggaacgagg ccacaaaagt 120 cccagcgaga gagcgcgttc aaatctcaga ctattccgat ttttaccgtt ttatcagata 180 gatggttcgg aactaataga gatgcaccac cacgcgagtg tggtggaatt gtccgagtct 240 gaggctcctc ggtatgcgtt accagcggaa gaagaccatg attttgacga cacagattgg 300 ttcgctggta acgagtgggc ggaagggtcg ttttga 336 //