ID JX473287; SV 1; linear; genomic RNA; STD; VRL; 603 BP. XX AC JX473287; XX DT 17-OCT-2012 (Rel. 114, Created) DT 17-OCT-2012 (Rel. 114, Last updated, Version 1) XX DE Barley yellow dwarf virus-PAV isolate PK4 coat protein gene, complete cds. XX KW . XX OS Barley yellow dwarf virus PAV OC Viruses; Riboviria; Luteoviridae; Luteovirus. XX RN [1] RP 1-603 RA Qadir A., Hameed S., Munir A., Abbas M.F.; RT ; RL Submitted (09-AUG-2012) to the INSDC. RL Crop Disease Research Program, Institute of Plants and Environmental RL Protection, Park Road, Islamabad, Islamabad 44000, Pakistan XX DR MD5; 2b53f71444a784e0f1ad9fdc252e8eaf. XX FH Key Location/Qualifiers FH FT source 1..603 FT /organism="Barley yellow dwarf virus PAV" FT /host="Sorghum halepense" FT /isolate="PK4" FT /mol_type="genomic RNA" FT /country="Pakistan" FT /collected_by="Abdul Qadir and Muhammad Fahim Abbas" FT /collection_date="27-Nov-2011" FT /identified_by="Abdul Qadir and Muhammad Fahhim Abbas" FT /PCR_primers="fwd_name: bpcf3, fwd_seq: FT atgaattcagtaggccgtaga, rev_name: bpcr2, rev_seq: FT ctatttggccgtcatcaaac" FT /db_xref="taxon:2169986" FT CDS 1..603 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:K4JEH5" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:K4JEH5" FT /protein_id="AFU76930.1" FT /translation="MNSVGRRGPSRNGINGTRRRRRRTVRPVVVVQPNRAGPRRRNGRR FT KGRGGANPVFRPTGGTEVFVFSVDNLKANSSGAIKFGPSLSQCPALSDGILKSYHRYKI FT TSIRVEFKSHASATTAGAIFIELDTACKQSALASYINSFTISKTASKVFRAEAINGKEF FT QESTIDQFWMLYKANGTTTDTAGQFIITMSVSLMTAK" XX SQ Sequence 603 BP; 177 A; 157 C; 148 G; 121 T; 0 other; atgaattcag taggccgtag aggacctagc cgtaacggca tcaatggcac aagaaggagg 60 cgccgtagaa cagttcggcc agtggttgtg gtccaaccca atcgagcagg acccagacga 120 cgaaatggtc gacgcaaggg aagaggaggg gcaaatcctg tatttagacc aacaggcggg 180 actgaggtat tcgtattctc agtcgacaac cttaaagcca actcttccgg ggcaatcaaa 240 ttcggcccca gtctatcgca atgcccagcg ctttcagacg gaatacttaa gtcctaccac 300 cgttacaaga tcacaagtat ccgtgttgag tttaagtcac acgcgtccgc aactacggcc 360 ggcgctatct ttattgaact cgacaccgcg tgcaaacaat cagccctggc tagctacatt 420 aattccttca caatcagcaa gaccgcctca aaggtcttca gagccgaagc gattaacggg 480 aaggaattcc aggaatcaac gatagaccag ttttggatgc tctacaaggc caatggaacc 540 accactgaca cggcaggaca attcattatc acgatgagtg tcagtttgat gacggccaaa 600 tag 603 //