ID JX067835; SV 1; linear; genomic RNA; STD; VRL; 603 BP. XX AC JX067835; XX DT 08-OCT-2012 (Rel. 114, Created) DT 08-OCT-2012 (Rel. 114, Last updated, Version 1) XX DE Barley yellow dwarf virus-PAV isolate SMS290_69 coat protein (ORF3) gene, DE complete cds. XX KW . XX OS Barley yellow dwarf virus PAV OC Viruses; Riboviria; Luteoviridae; Luteovirus. XX RN [1] RP 1-603 RA Mar T.B., Lau D., Schons J., Lau E.Y., Nhani A.; RT "Cloning and Phylogenetic Analysis of Coat Protein of Barley yellow dwarf RT virus Isolates from Brazil"; RL Unpublished. XX RN [2] RP 1-603 RA Mar T.B., Lau D., Schons J., Lau E.Y., Nhani A.; RT ; RL Submitted (11-MAY-2012) to the INSDC. RL CNPT, EMBRAPA, BR285 KM 294, Passo Fundo, RS 99001970, Brazil XX DR MD5; 3a68c7c7594f1af1fbeb3613b446e6f8. XX FH Key Location/Qualifiers FH FT source 1..603 FT /organism="Barley yellow dwarf virus PAV" FT /host="oat" FT /isolate="SMS290_69" FT /serotype="PAV" FT /mol_type="genomic RNA" FT /country="Brazil" FT /collection_date="Sep-2008" FT /db_xref="taxon:2169986" FT gene 1..603 FT /gene="ORF3" FT CDS 1..603 FT /codon_start=1 FT /gene="ORF3" FT /product="coat protein" FT /db_xref="GOA:K0I781" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:K0I781" FT /protein_id="AFU48516.1" FT /translation="MNSVGRRGPRRANQNGPRRRRRRTIRPVVVVQPNRAGPRRRNGRR FT KGRGGANPVFRPTGGTEVFVFSVDNLKANSSGAIKFGPSLSQCPALSDGILKSYHRYKI FT TSIRVEFKSHASATTAGAIFIELDTACKQSALGSYINSFTISKTASKVFRAEAINGKEF FT QESTIDQFWMLYKANGTTTDTAGQFIITMSVSLMTAK" XX SQ Sequence 603 BP; 178 A; 158 C; 146 G; 121 T; 0 other; atgaattcag taggccgtag aggacctaga cgcgcaaatc aaaatggccc aagaaggagg 60 cgccgtagaa caattcggcc agtggttgtg gtccaaccca atcgagcagg acccagacga 120 cgaaatggtc gacgcaaggg aagaggaggg gcaaatcctg tatttagacc aacaggcggg 180 actgaggtat tcgtattctc agttgacaac cttaaagcca actcctccgg ggcaatcaaa 240 ttcggcccca gtctatcgca atgcccagcg ctttcagacg gaatactcaa gtcctaccat 300 cgttacaaga tcacaagtat ccgagttgag tttaagtcac acgcgtccgc cactacggcc 360 ggcgctatct ttattgaact cgacaccgcg tgcaagcaat cagccctggg tagctacatt 420 aattccttca ccatcagcaa gaccgcctcc aaggtcttcc gggcagaggc aattaacggg 480 aaggaattcc aggaatcaac gatagaccaa ttttggatgc tctacaaggc taatggaacc 540 accactgaca ctgcaggaca attcattatc acgatgagtg tcagtttgat gacagccaaa 600 tag 603 //