ID JX025996; SV 1; linear; genomic RNA; STD; VRL; 657 BP. XX AC JX025996; XX DT 31-MAY-2013 (Rel. 116, Created) DT 31-MAY-2013 (Rel. 116, Last updated, Version 1) XX DE Cucumber mosaic virus isolate Mgh191 coat protein (3b) gene, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-657 RA Nematollahi S., Sokhandan Bashir N., Rakhshandehroo F., Zamanizadeh H.; RT "Molecular characterization of Cucumber mosaic virus isolates on the basis RT of CP, MP and 2b genes reveals evidence of phylogenetic position and RT symptomolgy"; RL Unpublished. XX RN [2] RP 1-657 RA Nematollahi S., Sokhandan Bashir N., Rakhshandehroo F., Zamanizadeh H.; RT ; RL Submitted (07-MAY-2012) to the INSDC. RL Plant Pathology, Azad University, College of Agriculture and Natural RL Resources, Science and Research Branch, Tehran, Iran XX DR MD5; 56c9d603059892c9bff3287b3afe0a44. XX FH Key Location/Qualifiers FH FT source 1..657 FT /organism="Cucumber mosaic virus" FT /segment="RNA3" FT /host="squash" FT /isolate="Mgh191" FT /mol_type="genomic RNA" FT /country="Iran:Maragheh" FT /collection_date="2009" FT /db_xref="taxon:12305" FT gene 1..657 FT /gene="3b" FT CDS 1..657 FT /codon_start=1 FT /gene="3b" FT /product="coat protein" FT /note="CP" FT /db_xref="GOA:Q9YJR3" FT /db_xref="InterPro:IPR000247" FT /db_xref="InterPro:IPR023800" FT /db_xref="InterPro:IPR037137" FT /db_xref="UniProtKB/TrEMBL:Q9YJR3" FT /protein_id="AGG16157.1" FT /translation="MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKT FT LSAGRPTINHPTFVGSERCKPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLV FT SRIQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQAN FT NKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDVEHQRIPTSGVLPV" XX SQ Sequence 657 BP; 158 A; 174 C; 150 G; 175 T; 0 other; atggacaaat ctgaatcaac cagtgctggt cgcaaccgtc gacgtcgtcc ccgtcgtggt 60 tcccgctccg ccccctcctc cgcggatgcc aactttagag tcttgtcgca gcagctttcg 120 cgacttaata agacgttgtc agctggtcgt ccaactatta accacccaac ctttgtaggg 180 agtgagcgtt gtaaacctgg atacacgttc acatctatta ccctaaagcc accaaaaata 240 gaccgtgggt cttattatgg taaaaggttg ttattacctg attcagtcac agaatatgat 300 aagaaacttg tttcgcgcat tcaaattcga gttaatcctt tgccgaaatt tgattctacc 360 gtgtgggtga cagtccgtaa agttcctgcc tcctcggact tatccgttgc cgccatctct 420 gctatgttcg cggacggagc ctcaccggta ctggtttatc agtatgctgc atctggagtc 480 caagctaaca acaaattgtt gtatgatctt tcggcgatgc gcgctgatat aggcgacatg 540 agaaagtacg ccgtcctcgt gtactcaaaa gacgatgcac tcgagacgga cgagctagta 600 cttcatgttg acgtcgagca ccaacgcatt cccacgtctg gggtgctccc agtataa 657 //