ID JX025979; SV 1; linear; genomic RNA; STD; VRL; 646 BP. XX AC JX025979; XX DT 31-MAY-2013 (Rel. 116, Created) DT 31-MAY-2013 (Rel. 116, Last updated, Version 1) XX DE Cucumber mosaic virus isolate Mgh91 2b protein (2b) gene, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-646 RA Nematollahi S., Sokhandan Bashir N., Rakhshandehroo F., Zamanizadeh H.; RT "Molecular characterization of Cucumber mosaic virus isolates on the basis RT of CP, MP and 2b genes reveals evidence of phylogenetic position and RT symptomolgy"; RL Unpublished. XX RN [2] RP 1-646 RA Nematollahi S., Sokhandan Bashir N., Rakhshandehroo F., Zamanizadeh H.; RT ; RL Submitted (07-MAY-2012) to the INSDC. RL Plant Pathology, Azad University, College of Agriculture and Natural RL Resources, Science and Research Branch, Tehran, Iran XX DR MD5; 847ad313c41bd29c84c728e4a38e0b70. XX FH Key Location/Qualifiers FH FT source 1..646 FT /organism="Cucumber mosaic virus" FT /segment="RNA2" FT /host="muskmelon" FT /isolate="Mgh91" FT /mol_type="genomic RNA" FT /country="Iran:Maragheh" FT /collection_date="2010" FT /db_xref="taxon:12305" FT gene 191..523 FT /gene="2b" FT CDS 191..523 FT /codon_start=1 FT /gene="2b" FT /product="2b protein" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:Q8B3M6" FT /protein_id="AGG16168.1" FT /translation="MELNVGAMTNVELQLARMVEAKKQRRRSHKQNRRERGHKSPSERA FT RSNLRLFRFLPFYQVDGSELTGSCRHVNVAELPESEASRLELSAEDHDFDDTDWFAGNE FT WAEGAF" XX SQ Sequence 646 BP; 175 A; 141 C; 174 G; 156 T; 0 other; gagttgaaat acaggaagtc cggggaagag gctgctttaa tgttaggcgc ctttaagaag 60 tacaccgcta atttccagtc ctacaaagaa ctctattatt cagatcgtcg tcagtgcgaa 120 ttgatcaatt cgttttgtag tacagagttc agggttgagc gtgtaaattc caacaaacag 180 cgaaagaaat atggaattga acgtaggtgc aatgacaaac gtcgaactcc aactggctcg 240 tatggtggag gcgaagaagc agagacgaag gtctcacaaa cagaatcgac gggaacgagg 300 tcacaaaagt cccagcgaga gagcgcgttc aaatctcaga ctattccgct tcctaccgtt 360 ctatcaagta gatggttcgg aactgacagg gtcatgccgc catgtgaacg tggcggagtt 420 acccgagtct gaggcctctc gtttagagtt atcggcggaa gaccatgatt ttgacgatac 480 agattggttc gccggtaacg aatgggcgga aggtgctttc tgaaacctcc ccttccgcat 540 ctccctccgg ttttctgtgg cgggagctga gttggcagtg ttgctataaa ctgtctgaag 600 tcactaaaca cattgtggtg aacgggttgt ccatccagct aacggc 646 //