ID JX025974; SV 1; linear; genomic RNA; STD; VRL; 665 BP. XX AC JX025974; XX DT 31-MAY-2013 (Rel. 116, Created) DT 31-MAY-2013 (Rel. 116, Last updated, Version 1) XX DE Cucumber mosaic virus isolate Zdj31 2b protein (2b) gene, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-665 RA Nematollahi S., Sokhandan Bashir N., Rakhshandehroo F., Zamanizadeh H.; RT "Molecular characterization of Cucumber mosaic virus isolates on the basis RT of CP, MP and 2b genes reveals evidence of phylogenetic position and RT symptomolgy"; RL Unpublished. XX RN [2] RP 1-665 RA Nematollahi S., Sokhandan Bashir N., Rakhshandehroo F., Zamanizadeh H.; RT ; RL Submitted (07-MAY-2012) to the INSDC. RL Plant Pathology, Azad University, College of Agriculture and Natural RL Resources, Science and Research Branch, Tehran, Iran XX DR MD5; 89033b733a3ebfe4d35afc24cbf245d5. XX FH Key Location/Qualifiers FH FT source 1..665 FT /organism="Cucumber mosaic virus" FT /segment="RNA2" FT /host="cucumber" FT /isolate="Zdj31" FT /mol_type="genomic RNA" FT /country="Iran:Zanjirabad" FT /collection_date="2010" FT /db_xref="taxon:12305" FT gene 53..385 FT /gene="2b" FT CDS 53..385 FT /codon_start=1 FT /gene="2b" FT /product="2b protein" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:H9BV34" FT /protein_id="AGG16163.1" FT /translation="MELNVGAMTNVELQLARMVEAKKQRRRSHKQNRRERGHKSPSERA FT RSNLRLFRFLPFYQVDGSELTGSYRHVNVAELPESEASRLELSAEDHDFDDTDWFAGNE FT WAEGAF" XX SQ Sequence 665 BP; 171 A; 156 C; 180 G; 158 T; 0 other; agtacagagt tcagggttga gcgtgtaaat tccaacaaac agcgaaagaa atatggaatt 60 gaacgtaggt gcaatgacaa acgtcgaact ccaactggct cgtatggtgg aggcgaagaa 120 gcagagacga aggtctcaca aacagaatcg acgggaacga ggtcacaaaa gtcccagcga 180 gagagcgcgt tcaaatctca gactattccg cttcctaccg ttctatcaag tagatggttc 240 ggaactgaca gggtcatacc gccatgtgaa cgtggcggag ttacccgagt ctgaggcctc 300 tcgtttagag ttatcggcgg aagaccatga ttttgacgat acagattggt tcgccggtaa 360 cgaatgggcg gaaggtgctt tctgaaacct ccccttccgc atctccctcc ggttttctgt 420 ggcgggagct gagttggcag tgttgctata aactgtctga agccactaaa cacattgtgg 480 tgaacgggtt gtccatccag cttacggcta aaatggtcag tcgtggagaa atctacgcca 540 gcagacttac aagtctctga ggcacctttg aaaccatctc ctaggtttct tcggaaggac 600 ttcggtccgt gtacttctag cacaacgtgc tagtttcagg gtacgggtgc cccccacttt 660 tgtgg 665 //