ID JQ920490; SV 1; circular; genomic DNA; STD; VRL; 3640 BP. XX AC JQ920490; XX DT 15-JUL-2012 (Rel. 113, Created) DT 26-JUL-2012 (Rel. 113, Last updated, Version 2) XX DE Citrus chlorotic dwarf associated virus isolate TK4, complete genome. XX KW . XX OS Citrus chlorotic dwarf associated virus OC Viruses; Geminiviridae. XX RN [1] RP 1-3640 RX DOI; 10.1016/j.virol.2012.06.005. RX PUBMED; 22749878. RA Loconsole G., Saldarelli P., Doddapaneni H., Savino V., Martelli G.P., RA Saponari M.; RT "Identification of a single-stranded DNA virus associated with citrus RT chlorotic dwarf disease, a new member in the family Geminiviridae"; RL Virology 432(1):162-172(2012). XX RN [2] RP 1-3640 RA Loconsole G., Saponari M.; RT ; RL Submitted (10-APR-2012) to the INSDC. RL Institute of Plant Virology, CNR, via Amendola, 165/a, Bari 70126, Italy XX DR MD5; 59fd6591f95c44f7cd2f716d13b7e7ea. DR EuropePMC; PMC5014472; 27774276. XX FH Key Location/Qualifiers FH FT source 1..3640 FT /organism="Citrus chlorotic dwarf associated virus" FT /host="Citrus sp." FT /isolate="TK4" FT /mol_type="genomic DNA" FT /country="Turkey" FT /collection_date="1995" FT /db_xref="taxon:1202142" FT CDS 194..613 FT /codon_start=1 FT /product="putative V2-like protein" FT /note="contains the geminivirus_V2 conserved domain FT pfam01524 associated to the successfull infection of the FT host and the conserved motif LxCxE, strongly conserved FT across geminivirus replication proteins, which interacts FT with retinoblastoma-related protein (RBR)" FT /db_xref="UniProtKB/TrEMBL:I6WN60" FT /protein_id="AFN40142.1" FT /translation="MCHYALSVQDLPESLFGLMSMLSVRYLKCVEEREMERSLMVGNPV FT GGALGNARILIRLIRRYCRCRDWVRKGRVNGEYQEWRTIWDKPCNDCGDAADVGHKEKK FT EAQVAEKGKEAQDCWGCICEGPAQEKVEQRCSSGV" FT CDS 417..1181 FT /codon_start=1 FT /product="putative coat protein-like protein" FT /note="contains the conserved domain pfam00844 of the FT geminivirus coat protein/nuclear export factor" FT /db_xref="GOA:I6XHV6" FT /db_xref="InterPro:IPR000263" FT /db_xref="InterPro:IPR000650" FT /db_xref="UniProtKB/TrEMBL:I6XHV6" FT /protein_id="AFN40145.1" FT /translation="MVSTRSGGQYGTSRVTTVETLPMWATKRRRRPRWPRKEKKPKIAG FT AVFVKARPRRKSSKGVPPGCKGPCKTHTVDVIKTIYHDGRGSGMISNIDRGDELGQREG FT RKIRVSRMIIRGKIWLDVNNASVPGSNLAKIWIFKDRRPGTEPVAFNALMDMSDSEPLS FT AFVKVDYRDRFIALHTMTVDLHGGKDFRVDELDLDELVEINSDVLFSHEDDGSVAHTIQ FT NGIFIYYACSDPRQTVQITAQARLYFYDSTSN" FT CDS 1211..2131 FT /codon_start=1 FT /product="putative BL1-like movement protein" FT /note="contains the conserved domain pfam00845 of the FT Geminivirus BL1 movement protein" FT /db_xref="GOA:I6XMA9" FT /db_xref="InterPro:IPR000211" FT /db_xref="UniProtKB/TrEMBL:I6XMA9" FT /protein_id="AFN40143.1" FT /translation="MDGQDLVLQDYHSTRRIEYPLSDEWQQIKLAFPSMKEISWHKLRG FT QCMKIDHCQIRYDPQVPANAEGNVLVVVHDRRMEADKSMQAEYTFPIRCGIELNYYSCS FT YFSLKDPVPWCVYYRVVNSTVLKGSHFCQFKARVKLSAAKSSSPIGFRGPSVKILNKAF FT NEDQVDFMHVGIPKSERVLCRSNSVLTTRPRLNLEAGESWASKSILSGEGGSEVGDSGP FT YRGLAQLGPDAIDPGDSASNLGDPKSVADEVIRRLNSSVIGMDLNSSKFAEIIGDAVLK FT GSVINSRDNQASTSNANDYKKKSLA" FT CDS complement(2300..>2707) FT /codon_start=1 FT /product="putative C1:C2-like protein" FT /note="start codon not known; contains ATPase Walker FT domain" FT /db_xref="GOA:I6X8D9" FT /db_xref="InterPro:IPR001301" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:I6X8D9" FT /protein_id="AFN40146.1" FT /translation="RAQEPDSKPDRPKSLYICGPSRSGKTAWARSLGLHNYFTGAIKFH FT DYNDHALYNVIDDIQYTKISHEVMKSLVGSQKNITVNIKYRPDRTIKGGIPSIICVNPD FT MDWLTYMSPTIKDWWNQNVLMHYMDPTDVFY" FT CDS complement(2611..3420) FT /codon_start=1 FT /product="putative RepA-like protein" FT /note="C1-like protein; contains the geminivirus Rep FT catalytic domain pfam00799 and the central domain pfam08283 FT of the geminivirus rep proteins" FT /db_xref="GOA:I6WCI5" FT /db_xref="InterPro:IPR001191" FT /db_xref="InterPro:IPR001301" FT /db_xref="InterPro:IPR022690" FT /db_xref="InterPro:IPR022692" FT /db_xref="UniProtKB/TrEMBL:I6WCI5" FT /protein_id="AFN40144.1" FT /translation="MASTSSSFRFSAKNIFLTYPKCPCTKEHLQAFLRLTLARFTITYM FT CVCEELHESGDPHLHAMIQCKKRVETQNPRFFDLLSVRRERSFHPCIESLKSPAASRKY FT LMKDGNYVEEGRFNSRARSPQKDQEKLWRDVLLEATDERSFLNLVRELRPSDFVLRWPA FT ISAFARDNYCRLREPFIPAFTEFPNLPEHVKQWAQQNILCVSKPFLQYELCYSCCPKAI FT FETECPINLQHHFWCDEHRNQTPSPTGPNPSTSAAQADQAKPPGPEV" FT repeat_region 3462..3510 FT /rpt_type=OTHER FT /rpt_unit_seq="taatattac" FT /note="contains the initiation site for the genome FT replication of geminiviruses; short palindromic sequences FT capable of forming hairpin-like structures" XX SQ Sequence 3640 BP; 1003 A; 611 C; 999 G; 1027 T; 0 other; atcccggtta ttggttaggt ttgaataggt attcaaattt tgattatgaa acgtgttggg 60 cacgtttcct cgtgctatat aaacgtggaa tactatgcgt atttgtacat ggagaaagga 120 ttatttgggg aacacacgga gaaggtattg atctgtgtac ttgttttttt ttattcaatc 180 caaatcataa gcaatgtgtc attatgcatt aagtgttcaa gatttgcccg agagtttgtt 240 cggtttaatg agcatgttga gtgtgaggta tttaaagtgt gtggaagaga gggaaatgga 300 gagaagccta atggtaggga atcccgtagg aggagccctg ggtaatgctc gtatacttat 360 acggttaata cgtagatact gcaggtgtag agactgggta aggaaaggta gggtcaatgg 420 tgagtaccag gagtggagga caatatggga caagccgtgt aacgactgtg gagacgctgc 480 cgatgtgggc cacaaagaga agaaggaggc ccaggtggcc gagaaaggaa aagaagccca 540 agattgctgg ggctgtattt gtgaaggccc ggcccaggag aaagtcgagc aaaggtgttc 600 ctccggggtg taagggccca tgtaaaacac acacggtgga tgtgataaag actatttatc 660 acgatggccg tggatctgga atgatttcaa atattgaccg aggtgatgag ctaggtcaaa 720 gggaaggaag gaaaataagg gtttcacgta tgatcatacg tggcaagatc tggttggacg 780 tgaataatgc atccgtacca ggaagcaatt tagctaaaat atggattttc aaggatagga 840 gaccggggac tgaaccggtt gcttttaatg cgctgatgga tatgtctgat tcagaaccac 900 tcagtgcatt tgtgaaggtt gactacaggg acaggtttat tgcccttcac actatgacgg 960 tagacctgca cggtggaaag gattttaggg ttgacgagct tgacttggat gagttagttg 1020 agataaacag tgatgttttg tttagtcatg aggacgatgg gtctgtggcc catacgatcc 1080 aaaatggtat ttttatatat tatgcttgta gtgatcctag acagactgtg caaataactg 1140 cacaggctcg attgtatttt tatgattcta catcaaatta ataaaattta atattttttt 1200 ttaaaataga atggacggtc aagatttggt gttacaagac tatcatagca cgagacgtat 1260 tgaataccct ctaagtgatg agtggcagca gataaagctt gcattcccta gtatgaagga 1320 gattagctgg cataagttac gtggtcaatg catgaaaatt gaccattgtc agatacggta 1380 tgatccgcaa gtacctgcta atgcagaagg gaatgtattg gttgtggtac acgatagacg 1440 tatggaagct gacaagtcaa tgcaagctga atatactttt ccaatacgat gtggaataga 1500 acttaattac tattcctgtt cgtatttttc gttgaaggac ccagtaccat ggtgtgtata 1560 ctatagggtt gtgaactcta ctgtgttgaa gggttctcat ttttgtcaat ttaaggcgcg 1620 cgtgaagcta agcgcggcta aatcaagtag cccaattggg ttcaggggtc caagtgttaa 1680 gattttaaac aaggcattca acgaagacca ggtggatttc atgcacgtgg gcatcccgaa 1740 gtcagaaagg gtgttatgca ggagtaatag tgttttaacg acccggccca gattgaatct 1800 tgaggctggg gagagttggg cctcgaaaag tatattatca ggcgaaggtg gatcggaggt 1860 tggtgattcc ggcccatata ggggtttggc tcagttaggc ccagacgcga ttgatccagg 1920 tgatagcgcg tctaatttgg gtgatccaaa atcagttgcg gatgaagtca ttagaagact 1980 taacagttca gttattggga tggacttaaa cagttcaaaa tttgcagaga taattggaga 2040 tgcagtactc aagggaagtg tgatcaacag tagagataat caggcctcaa caagtaatgc 2100 taatgattat aagaaaaaaa gcttggctta aaattgtata atttgtaatt aacggggtac 2160 gcttaagcat ttgtttgagc cgaggctttc gaggcgagtc accccgaaat ataatttgcc 2220 agaaaatcaa tatgtttatt atagataata aaggcacgaa gtgccgtaca aggatacgaa 2280 atcaaataca cgcaaacaac tagtagaata catcagtggg gtccatataa tgcataagta 2340 cattttggtt ccaccagtcc tttattgtgg gtgacatata agttaaccag tccatatctg 2400 gattaacaca tattatggac ggtatgcctc ccttaatagt gcgatcgggt ctatacttaa 2460 tgttaacggt aatgtttttt tgggacccca ctaaggattt cataacctca tgtgagattt 2520 tggtgtattg gatgtcatca atgacgttat acagtgcgtg gtcgttgtag tcgtggaatt 2580 tgatggcacc cgtgaagtag ttgtgtaggc ctaaacttct ggcccaggcg gttttgcctg 2640 atcggcttgg gccgcagatg tagagggatt tgggcctgtc gggcttggag tctggttcct 2700 gtgctcgtca caccagaagt gatgttgcaa attaattggg cactcagtct caaatattgc 2760 ttttggacag caggaataac acagttcata ctgtaaaaat ggtttactta cacataggat 2820 gttctgctgg gcccactgct tgacgtgttc aggaaggttc gggaattctg tgaaagcagg 2880 tatgaacggt tcacgtagtc tgcagtagtt gtcacgtgcg aacgctgaga tcgctggcca 2940 tctgaggacg aagtctgatg gtctgagctc tctgactagg ttaaggaagg accgttcgtc 3000 ggttgcctcg aggagcacgt ccctccacag tttttcttga tccttttgtg gggatcgtgc 3060 tctggagttg aagcgtcctt cctccacata gttgccgtcc ttcatgaggt attttctgga 3120 ggcggctggt gatttcaagg actcgataca gggatggaat gacctctctc tgcgtacgga 3180 gaggaggtcg aagaaccggg ggttctgtgt ttcgacccgt ttcttgcact ggatcatggc 3240 atgaaggtgt gggtctccgg attcgtggag ttcctcacac acgcacatgt aagtgattgt 3300 gaatcgtgcg agtgttagtc gaaggaaagc ttggaggtgt tccttggtgc atgggcactt 3360 ggggtatgta aggaaaatat ttttggctga gaatcggaag ctagaggaag tggaagccat 3420 gttgtacgga ttggtggagg aaagattagc ccccttatgg tagtgggagt gggagtgcca 3480 attttatata atattacagg cactcccact gtgacacgtg gcagtttagc agccacaaac 3540 agagatatga ttgagagatg ctctacgtgg aataacctga ggccgttaga tttgtgtttc 3600 tcactttaaa taataaccat tggatgagct atccatgcga 3640 //