ID JQ818255; SV 1; linear; genomic RNA; STD; VRL; 960 BP. XX AC JQ818255; XX DT 02-APR-2013 (Rel. 116, Created) DT 21-AUG-2013 (Rel. 117, Last updated, Version 3) XX DE Garlic common latent virus isolate JNWG coat protein gene, complete cds. XX KW . XX OS Garlic common latent virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-960 RX DOI; 10.1007/s11262-013-0909-z. RX PUBMED; 23553322. RA Pramesh D., Baranwal V.K.; RT "Molecular characterization of coat protein gene of Garlic common latent RT virus isolates from India: an evidence for distinct phylogeny and RT recombination"; RL Virus Genes 47(1):189-193(2013). XX RN [2] RP 1-960 RA Pramesh D., Baranwal V.K.; RT ; RL Submitted (06-MAR-2012) to the INSDC. RL Division of Plant Pathology, Indian Agricultural Research Institute, Pusa, RL New Delhi, Delhi 110012, India XX DR MD5; b25d728b6e46e16e20372d3528ff8fcc. XX FH Key Location/Qualifiers FH FT source 1..960 FT /organism="Garlic common latent virus" FT /host="garlic" FT /isolate="JNWG" FT /mol_type="genomic RNA" FT /country="India" FT /isolation_source="garlic cloves" FT /collected_by="Pramesh D" FT /collection_date="02-Nov-2010" FT /db_xref="taxon:47900" FT CDS 1..960 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:M4H4N2" FT /db_xref="InterPro:IPR000052" FT /db_xref="InterPro:IPR013569" FT /db_xref="UniProtKB/TrEMBL:M4H4N2" FT /protein_id="AFO83501.1" FT /translation="MSGSETEEQRSRRLASERSDAERRKNDAAVRARQDAAIDSEEPTD FT VQETSVNDVDLRQMENRVQEAKRFLERFNKLKKFQADNMTAGEIKNGGFETGRPKLNIA FT ANLRGDTANVFTRPSMDALIALDFKAESLAVATAEDLAAITAKFEQLGVPTERLAPLCW FT SIARYCADTSSSYVADPKGTFEYPGGAITRDAVYAVIKEVTTLRAFCRAFAPVVWNEML FT IAKRPPAGWQTKGYTASTKYAAFDTFDYVLNSACVQPLEGIIRVPTDEETIAHMTNKRI FT AIDRNRRNGRFSSTNSLVTGGMFGKDIKTNFNGSNNAD" XX SQ Sequence 960 BP; 275 A; 189 C; 263 G; 233 T; 0 other; atgtcaggga gtgaaacaga ggaacagaga tcacgaagac tggcttcaga gaggagcgat 60 gctgaacgcc ggaaaaatga tgcagctgtg agagctaggc aggatgctgc tatcgattct 120 gaggaaccta ctgatgtgca agagacgagc gttaatgatg ttgatctgcg tcaaatggaa 180 aatagggtcc aggaagctaa gcggtttttg gagcgcttca ataagcttaa gaagttccaa 240 gcggacaaca tgacagcagg tgagatcaag aatggagggt ttgaaactgg gaggccaaaa 300 ctgaatattg cagccaattt gcgcggcgac actgctaatg tattcactag gcctagcatg 360 gatgctttaa tagcgttgga cttcaaggct gaatctttgg cagttgcgac tgcagaggac 420 ctagctgcca tcaccgctaa atttgaacag cttggggtgc caactgagag attagctcca 480 ctttgttggt cgattgcaag gtattgtgca gatacgagtt cctcatacgt ggctgatccg 540 aaaggaactt ttgaataccc agggggtgct ataacaaggg acgctgttta tgccgtcatc 600 aaagaagtta cgaccctgag ggctttctgc agagctttcg caccagtggt ttggaatgag 660 atgttaatcg ctaaaagacc tcctgctggt tggcaaacca aaggttacac tgctagcaca 720 aagtatgctg cctttgatac tttcgattac gtgcttaatt ctgcttgtgt ccagccactt 780 gaggggatca tacgggttcc aactgatgag gagactatag cgcacatgac caacaagcgg 840 attgctattg ataggaatag gcgcaatggt cggttttcaa gcacaaacag tttagttact 900 gggggcatgt tcggtaagga tatcaaaaca aacttcaatg gatccaacaa tgcagactag 960 //