ID JQ070382; SV 1; linear; genomic RNA; STD; VRL; 1175 BP. XX AC JQ070382; XX DT 15-APR-2012 (Rel. 112, Created) DT 15-APR-2012 (Rel. 112, Last updated, Version 1) XX DE Eubenangee virus isolate AUS1963/01 segment 7, complete sequence. XX KW . XX OS Eubenangee virus OC Viruses; Riboviria; Reoviridae; Sedoreovirinae; Orbivirus. XX RN [1] RC Publication Status: Online-Only RP 1-1175 RX PUBMED; 22438872. RA Belaganahalli M.N., Maan S., Maan N.S., Nomikou K., Pritchard I., Lunt R., RA Kirkland P.D., Attoui H., Brownlie J., Mertens P.P.; RT "Full Genome Sequencing and Genetic Characterization of Eubenangee Viruses RT Identify Pata Virus as a Distinct Species within the Genus Orbivirus"; RL PLoS One 7(3):E31911-E31911(2012). XX RN [2] RP 1-1175 RA Belaganahalli M.N., Maan S., Maan N.S., Nomikou K., Mertens P.P.C.; RT ; RL Submitted (22-NOV-2011) to the INSDC. RL Vector-borne Viral Diseases Programme, Institute for Animal Health, RL Pirbright laboratory, Ash Road Pirbright, Woking, Surrey GU24 0NF, United RL Kingdom XX DR MD5; 6217c03e7c8231cdd46e7ebdd226c952. XX CC GenBank Accession Numbers JQ070376-JQ070385 represent the complete CC genome of Eubenangee virus isolate AUS1963/01. XX FH Key Location/Qualifiers FH FT source 1..1175 FT /organism="Eubenangee virus" FT /segment="7" FT /host="mosquitoes (from mix of 11 species)" FT /isolate="AUS1963/01" FT /mol_type="genomic RNA" FT /country="Australia" FT /collected_by="Doherty and colleagues" FT /collection_date="1963" FT /note="infects marsupials and cattle" FT /db_xref="taxon:40056" FT CDS 21..1073 FT /codon_start=1 FT /product="VP7" FT /note="major core protein; T13" FT /db_xref="GOA:H9ZXR8" FT /db_xref="InterPro:IPR001803" FT /db_xref="InterPro:IPR008935" FT /db_xref="InterPro:IPR008980" FT /db_xref="InterPro:IPR023176" FT /db_xref="InterPro:IPR023178" FT /db_xref="UniProtKB/TrEMBL:H9ZXR8" FT /protein_id="AFH41515.1" FT /translation="MDAIVARALTVLKACITLQEPRVTAEGTVMEVLGIAVNRYNGMTQ FT NAVTMRPVSQTDRNAMFFMCLDMVLSALNINVGNISNDYQQNQGTIAVLATPEIPYSVE FT AANEVTRLSTEAMTWGPDRQTEGPYTEVGLVVQPGRYHQAANANVTCSYVDSKILQVSL FT AAGAQRDIQRALLPQNVEAVMVYFVWRRYEIFSMPNGASQESPANMLLRVGGIEMRMGR FT VVAWNGRAAVTVVNNGQREGMIQIEVLWHSSLTKTLNQAPGFGAQLFSVYAYRNAIWTA FT LRTSILNRTTLPNIVPPIYPPSDKAEIMTIILLARLGDLFSVLNPDFTIHGAAAPGGPV FT DRAQALGAYR" XX SQ Sequence 1175 BP; 323 A; 240 C; 327 G; 285 T; 0 other; gttaaaattc cagttgcaag atggatgcga tagtagcacg cgcgttgacc gttctcaaag 60 catgtataac attacaggaa ccgagagtta cagccgaagg taccgtaatg gaagtgttgg 120 gaatagcggt taatcgttac aatggaatga ctcaaaatgc agttactatg agaccagttt 180 cacagactga tcgtaacgca atgtttttca tgtgtttaga tatggtattg tctgctttga 240 atattaacgt tgggaacatt tcaaatgatt atcagcagaa ccaaggtact attgcagtgt 300 tagcgacgcc tgaaatacca tattcagtcg aagcagctaa tgaagttacg cgattatcta 360 ctgaggcgat gacctgggga cctgatagac aaacagaggg accttataca gaagtggggt 420 tggtggtgca gccgggacgc tatcatcaag cagcgaatgc aaacgtcacg tgcagctatg 480 tagactcaaa aatattgcaa gtgtcactgg cggcgggcgc acagcgagat atccaacgcg 540 cgctgctgcc acaaaatgtc gaagcggtga tggtttactt cgtgtggaga cgctatgaga 600 tattctctat gcctaatggc gcgtcgcaag aatcgccagc aaatatgctg ttaagagtgg 660 gcgggatcga aatgcgcatg gggcgggtag tagcttggaa tggacgagca gcggtcactg 720 tcgttaacaa cggtcaaagg gaaggaatga tacaaattga agtactgtgg cattcatcgc 780 tgactaaaac gttgaaccaa gcgcccggct tcggcgcgca gttgttcagc gtatacgcgt 840 atcgaaacgc aatatggact gcgctgagaa cgtcgatatt aaataggact acgttaccga 900 atattgttcc accgatatat ccacccagcg ataaggcgga aataatgacc atcatattgt 960 tagcaaggtt gggggatttg ttttcagtgc tgaatccaga ctttacaata catggcgcag 1020 ccgcaccggg ggggccggtc gatcgcgcgc aggcgcttgg cgcttataga tagggaatgg 1080 gacgtttgca cagttgcgtc ccttggtcta tgggcgacgc atcggttggc gttacagcgg 1140 gtaacgtttt atacgtctac tgggatgcaa cttac 1175 //