ID JN871584; SV 1; linear; genomic DNA; STD; VRL; 224 BP. XX AC JN871584; XX DT 26-FEB-2012 (Rel. 111, Created) DT 26-FEB-2012 (Rel. 111, Last updated, Version 1) XX DE Squash leaf curl virus isolate LBm1 truncated coat protein (AV1) gene, DE complete cds. XX KW . XX OS Squash leaf curl virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-224 RA Jawhari M., Samsatly J., Sobh H., Abou-Jawdah Y.; RT "Detection, incidence and molecular characterizations of Squash leaf curl RT virus, Watermelon chlorotic stunt virus and other whitefly-transmitted RT viruses causing a major threat to cucurbit production in Lebanon"; RL Unpublished. XX RN [2] RP 1-224 RA Jawhari M., Samsatly J., Sobh H., Abou-Jawdah Y.; RT ; RL Submitted (19-OCT-2011) to the INSDC. RL Plant Protection, American University of Beirut, Bliss Street - Hamra, RL Beirut 7546, Lebanon XX DR MD5; 6252c244a93265a47dddcabc5d0cf4af. XX FH Key Location/Qualifiers FH FT source 1..224 FT /organism="Squash leaf curl virus" FT /segment="DNA-As" FT /host="Cucumis sativus" FT /isolate="LBm1" FT /mol_type="genomic DNA" FT /country="Lebanon" FT /collection_date="Nov-2009" FT /db_xref="taxon:10829" FT gene 1..224 FT /gene="AV1" FT CDS 1..162 FT /codon_start=1 FT /gene="AV1" FT /product="truncated coat protein" FT /db_xref="GOA:H6VSX9" FT /db_xref="UniProtKB/TrEMBL:H6VSX9" FT /protein_id="AFB69850.1" FT /translation="MVKRDAPWRLMAGTSKVSRSANFSPRGGMGPRFNKAAAWVNRPMY FT RKPGSIAQ" XX SQ Sequence 224 BP; 63 A; 56 C; 64 G; 41 T; 0 other; atggtaaaga gagatgcccc atggcgttta atggcgggga cctcaaaggt ctcacgctct 60 gctaactttt cgcctcgtgg aggtatgggc ccaagattca acaaggccgc tgcatgggtt 120 aacaggccca tgtacagaaa gccaggatct atcgcacaat gagaggccca gacatcccca 180 agggatggaa gggccatgca aggttcatac tacgagacgg acaa 224 //