ID JN792471; SV 1; linear; genomic RNA; STD; VRL; 711 BP. XX AC JN792471; XX DT 18-APR-2012 (Rel. 112, Created) DT 18-APR-2012 (Rel. 112, Last updated, Version 1) XX DE Apple stem grooving virus isolate A211 coat protein gene, partial cds. XX KW . XX OS Apple stem grooving virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Trivirinae; OC Capillovirus. XX RN [1] RP 1-711 RA Kim J.D., Kwark H.R., Kim M.K., Kim C.S., Lee G.S., Lee S.C., Choi H.S.; RT "Apple stem grooving virus coat protein gene"; RL Unpublished. XX RN [2] RP 1-711 RA Kim J.D., Kwark H.R., Kim M.K., Lee G.S., Kim C.S., Lee S.C., Choi H.S.; RT ; RL Submitted (27-SEP-2011) to the INSDC. RL Departement of Agricultural Biology, Division of Crop protection, National RL academy of Agricultural Science, RDA, 150, Suinro, Kwoenseon-gu, Suwon, RL Gyeongi-do 441-707, Repubilc of korea XX DR MD5; 5573936e486cc49e5cdddb76b479caab. DR EuropePMC; PMC6305176; 30588230. XX FH Key Location/Qualifiers FH FT source 1..711 FT /organism="Apple stem grooving virus" FT /host="apple" FT /isolate="A211" FT /mol_type="genomic RNA" FT /country="South Korea:Nonsan" FT /collection_date="Sep-2008" FT /db_xref="taxon:28347" FT CDS 1..>711 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:I0CE87" FT /db_xref="InterPro:IPR008879" FT /db_xref="UniProtKB/TrEMBL:I0CE87" FT /protein_id="AFH75100.1" FT /translation="MSLEDVLQLARRHRVGVYLWKTHIDPAKELLTVPPPEGFKEGESF FT EGRELYLLLCNHYCKYLFGNIAVFGSSDKTQFPAVGFDTPPVHYNLTTTPKQGETEEEK FT KVREGSSGEKTKIWRVDLSNVVPELKTFAATSRQNSLNECTFRKLCEPFADLAREFLHE FT RWSKGLATNIYKKWPKAFEKSPWVAFDFATGLKMNRLTPDEKQVIDRMTKRLFRTEGQK FT GVFEAGSESNLELEG" XX SQ Sequence 711 BP; 205 A; 141 C; 181 G; 184 T; 0 other; atgagtttgg aagacgtgct tcaactagcg aggcgccacc gggtaggagt gtatctctgg 60 aagactcaca tagacccggc aaaggaactt ctgacggttc ctccccctga agggttcaaa 120 gaaggtgaaa gctttgaagg cagagagctt taccttcttc tctgcaatca ctattgtaaa 180 tatttatttg gaaatattgc tgtttttggg tcttctgata agacccagtt tcccgctgta 240 ggttttgata ctccaccagt tcattacaac ttgacaacga ccccaaaaca aggggaaact 300 gaagaagaga agaaagtcag agaagggtcg tctggcgaaa aaactaagat ttggagggtc 360 gacttgtcaa atgttgtccc tgaattgaaa acctttgctg ctacttctcg gcagaactct 420 ctgaacgaat gtacgttccg aaagctttgt gagccttttg ctgatttggc tcgtgaattt 480 cttcatgaac ggtggtccaa aggattggcc accaacatat acaagaaatg gcccaaagct 540 tttgagaaaa gcccatgggt ggcatttgat tttgccaccg gtctgaaaat gaaccgtctg 600 acacctgatg aaaagcaggt aattgacagg atgacaaaga ggctttttcg tacagaagga 660 cagaaagggg ttttcgaggc aggttcggag agtaacttag aactggaggg t 711 //