ID JN711115; SV 1; linear; genomic RNA; STD; VRL; 480 BP. XX AC JN711115; XX DT 05-DEC-2011 (Rel. 111, Created) DT 09-NOV-2012 (Rel. 114, Last updated, Version 2) XX DE Tobacco mosaic virus isolate YL coat protein gene, complete cds. XX KW . XX OS Tobacco mosaic virus OC Viruses; Riboviria; Virgaviridae; Tobamovirus. XX RN [1] RP 1-480 RX DOI; 10.1016/j.jviromet.2012.03.029. RX PUBMED; 22484613. RA Dai J., Cheng J., Huang T., Zheng X., Wu Y.; RT "A multiplex reverse transcription PCR assay for simultaneous detection of RT five tobacco viruses in tobacco plants"; RL J. Virol. Methods 183(1):57-62(2012). XX RN [2] RP 1-480 RA Jin D.; RT ; RL Submitted (22-SEP-2011) to the INSDC. RL College of Plant Protection, Northwest A&F University, Taicheng Road 22, RL Xian, Shaanxi 712100, China XX DR MD5; fa1aac1e4c24e905f94430aa2087f432. XX FH Key Location/Qualifiers FH FT source 1..480 FT /organism="Tobacco mosaic virus" FT /host="tobacco" FT /isolate="YL" FT /mol_type="genomic RNA" FT /country="China" FT /collection_date="27-Jul-2010" FT /db_xref="taxon:12242" FT CDS 1..480 FT /codon_start=1 FT /product="coat protein" FT /note="CP" FT /db_xref="GOA:Q77H57" FT /db_xref="InterPro:IPR001337" FT /db_xref="InterPro:IPR036417" FT /db_xref="UniProtKB/TrEMBL:Q77H57" FT /protein_id="AEU12504.1" FT /translation="MSYSITTPSQFVFLSSAWADPIELINLCTNALGNQFQTQQARTVV FT QRQFSEVWKPSPQVTVRFPDSDFKVYRYNAVLDPLVTALLGAFDTRNRIIEVENQANPT FT TAETLDATRRVDDATVAIRSAINNLVVELIRGTGSYNRSSFESSSGLVWTSGPAT" XX SQ Sequence 480 BP; 141 A; 102 C; 108 G; 129 T; 0 other; atgtcttaca gtatcactac tccatctcag ttcgtgttct tgtcatcagc gtgggccgac 60 ccaatagagt taattaattt atgtactaat gccttaggta atcagtttca aacacaacaa 120 gctcgaactg tcgttcaaag acaattcagt gaggtgtgga aaccttcacc acaagtaact 180 gttaggttcc ctgacagtga ctttaaggtg tacaggtaca atgcggtatt agacccgcta 240 gtcacagcac tattaggtgc atttgacact agaaatagaa taatagaagt tgaaaatcag 300 gcgaacccca cgactgccga aacgttggac gctactcgta gagtagacga cgcaacggtg 360 gccataagga gcgctataaa taatttagta gtagaattga tcagaggaac cggatcctat 420 aatcggagct ctttcgagag ctcttctggt ttggtttgga cctctggtcc tgcaacttga 480 //