ID JF836812; SV 1; linear; genomic RNA; STD; VRL; 825 BP. XX AC JF836812; XX DT 14-AUG-2011 (Rel. 109, Created) DT 16-AUG-2011 (Rel. 109, Last updated, Version 2) XX DE Tomato yellow ring virus strain TYRV-s nucleocapsid (N) gene, complete cds. XX KW . XX OS Tomato yellow ring virus OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Ellioviricetes; OC Bunyavirales; Tospoviridae; unclassified Tospoviridae. XX RN [1] RP 1-825 RA Hassani-Mehraban A., Peters D., Kormelink R.; RT "Tomato yellow ring virus (TYRV-s) infecting potato in Teheran province, RT Iran"; RL Unpublished. XX RN [2] RP 1-825 RA Hassani-Mehraban A., Peters D., Kormelink R.; RT ; RL Submitted (26-APR-2011) to the INSDC. RL Plant Sciences, Laboratory of Virology, Wageningen University, RL Droevendaalsesteeg 1, Wageningen 6708 PB, The Netherlands XX DR MD5; 3762b211cbd03cdb2ad454b3e912bb6e. XX FH Key Location/Qualifiers FH FT source 1..825 FT /organism="Tomato yellow ring virus" FT /host="Solanum tuberosum" FT /strain="TYRV-s" FT /mol_type="genomic RNA" FT /country="Iran:Teheran Province" FT /isolation_source="leaf" FT /collection_date="20-Nov-2002" FT /db_xref="taxon:304859" FT gene 1..825 FT /gene="N" FT CDS 1..825 FT /codon_start=1 FT /gene="N" FT /product="nucleocapsid" FT /db_xref="GOA:G1CRD0" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:G1CRD0" FT /protein_id="AEL97503.1" FT /translation="MSTARVSKEKIEKLLAGGEADVVIEAEEAAGFNFKEFVLANKTMK FT MTFNNGYTILRNRAGIYKMVKAGQFKFQGKPIVVPSATVSAGQDDWTFRRLEGFIRAKM FT FMELIAVENVAEQQKMYEKLCELPMVSAYGLKPSSKFDATTARVMLTLGGPLPLMASLD FT KFAACAFPLAYFQNVKKESLGISKFSTYEQLCKIARVMATKGFDFADVSKDIFEETIKI FT LNDCTPGAAGAASLNKFNEQIKALESTFGKIVDDTGAGSSKPKPTSKKNDAF" XX SQ Sequence 825 BP; 253 A; 146 C; 204 G; 222 T; 0 other; atgtctaccg caagggtaag caaagagaaa attgagaagc ttcttgccgg tggcgaagca 60 gatgtagtga tcgaggctga ggaagctgca gggttcaact tcaaggagtt tgttctggct 120 aacaaaacca tgaagatgac attcaataac ggttacacaa ttttaaggaa cagagcaggg 180 atttacaaaa tggtaaaagc aggtcaattt aaattccaag gaaagcctat tgttgtgcct 240 agtgctactg tgagtgctgg tcaagatgat tggacattca gaaggttgga gggcttcatc 300 agagcaaaga tgttcatgga gctgattgct gtggaaaatg tggctgagca gcagaaaatg 360 tatgagaagc tttgtgagct tcccatggtg agcgcatatg gtttgaaacc gagctcaaag 420 tttgatgcaa ccacagccag agtaatgttg acattgggtg gtcctctccc tctgatggca 480 agtcttgata aatttgctgc atgtgcattt ccactggctt attttcagaa tgtaaagaaa 540 gaatctttag gcataagtaa attttcaact tatgagcagc tgtgcaagat cgccagagta 600 atggctacta agggatttga ttttgctgat gtttccaagg acatctttga agaaaccata 660 aaaatcctca atgactgcac tccaggagct gctggtgctg cttcattgaa caaattcaat 720 gagcagatta aagctcttga aagcaccttt ggaaagattg ttgatgacac tggtgctggg 780 tcttctaaac ccaagcctac ctccaaaaag aacgatgcat tttaa 825 //