ID JF808216; SV 1; linear; genomic RNA; STD; VRL; 777 BP. XX AC JF808216; XX DT 31-JUL-2012 (Rel. 113, Created) DT 05-AUG-2023 (Rel. 144, Last updated, Version 2) XX DE Tomato spotted wilt virus isolate TN-1 nucleocapsid protein gene, complete DE cds. XX KW . XX OS Orthotospovirus tomatomaculae OC Viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; OC Ellioviricetes; Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-777 RA Khatabi B., Hajimorad M.R.; RT "Molecular characterization of Tomato spotted wilt virus isolates from RT Tennessee"; RL Unpublished. XX RN [2] RP 1-777 RA Khatabi B., Hajimorad M.R.; RT ; RL Submitted (14-APR-2011) to the INSDC. RL Entomology and Plant Pathology, The University of Tennessee, 2431 Joe RL Johnson Drive, 205 Ellington Plant Science Building, Knoxville, TN 37996, RL USA XX DR MD5; 5c38abc433b494367d9f11da4edd3cf5. XX FH Key Location/Qualifiers FH FT source 1..777 FT /organism="Orthotospovirus tomatomaculae" FT /isolate="TN-1" FT /mol_type="genomic RNA" FT /db_xref="taxon:3052585" FT CDS 1..777 FT /codon_start=1 FT /product="nucleocapsid protein" FT /db_xref="GOA:I6PD65" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:I6PD65" FT /protein_id="AFH14522.1" FT /translation="MSKVKLTKENIVALLTQSKDLEFEEDQNLVAFNFKTFCLENLDQI FT KKMSIISCLTFLKNRQSIMKVIKQSDFTFGKITIKKTSNRVGATDMTFRRLDSLIRVRL FT VEETGNSENLNTIKSKIASHPLIQAYGLPLDDAKSVRLAIMLGGSLPLIASVDSFEMIS FT VVLAIYQDAKYKDLGIDPKKYDTKEALGKVCTVLKSKAFEMNEDQVKKGKEYAAILSSS FT NPNAKGSIAMEHYSETLNKFYEMFGVKKQAKLAELA" XX SQ Sequence 777 BP; 260 A; 132 C; 169 G; 216 T; 0 other; atgtctaagg ttaagctcac taaggaaaac attgttgctt tgttgacaca aagcaaagac 60 cttgaatttg aggaagatca gaatctggta gcattcaact tcaagacttt ttgtctggaa 120 aaccttgacc agatcaagaa aatgagcatt atttcatgtc tgacattcct aaagaatcgt 180 cagagtataa tgaaggttat taagcaaagt gattttactt ttggtaaaat taccataaag 240 aaaacttcaa acagggttgg agccactgac atgaccttca gaaggcttga tagcttgatc 300 agggtcaggc tcgttgagga aactgggaat tctgagaatc tcaatactat caaatctaag 360 attgcttctc accctttgat tcaagcctat ggattacctc ttgatgatgc aaagtctgtg 420 aggcttgcca taatgctggg aggtagctta cctcttattg cttcagttga tagctttgag 480 atgatcagtg ttgtcctggc tatatatcag gatgcaaaat acaaagacct cgggatcgac 540 ccaaagaagt atgacaccaa ggaagcctta gggaaagttt gcactgtgtt gaaaagcaaa 600 gcatttgaaa tgaacgaaga tcaggtgaag aaagggaaag agtatgctgc tatacttagt 660 tccagcaatc ctaatgctaa aggaagtatt gctatggaac attacagtga aactcttaac 720 aagttctatg aaatgttcgg ggttaaaaaa caggcaaaac ttgcagaact tgcttaa 777 //