ID JF807053; SV 1; linear; genomic RNA; STD; VRL; 750 BP. XX AC JF807053; XX DT 28-SEP-2011 (Rel. 110, Created) DT 30-SEP-2011 (Rel. 110, Last updated, Version 2) XX DE Cucurbit chlorotic yellows virus coat protein gene, partial cds. XX KW . XX OS Cucurbit chlorotic yellows virus OC Viruses; Riboviria; Closteroviridae; Crinivirus; unclassified Crinivirus. XX RN [1] RP 1-750 RX DOI; .1094/PDIS-04-11-0349. RX PUBMED; 30731657. RA Hamed K., Menzel W., Dafalla G., Gadelseed A., Winter S.; RT "First Report of Cucurbit chlorotic yellows virus Infecting Muskmelon and RT Cucumber in Sudan"; RL Plant Dis. 95(10):1321-1321(2011). XX RN [2] RP 1-750 RA Menzel W., Hamed K., Dafalla G., Gadelseed A., Winter S.; RT ; RL Submitted (12-APR-2011) to the INSDC. RL Plant Virus Department, DSMZ-Deutsche Sammlung von Mikroorganismen und RL Zellkulturen GmbH, Inhoffenstrasse 7B, Braunschweig 38124, Germany XX DR MD5; fd2ae648636b2c09695079250c15dcfc. XX FH Key Location/Qualifiers FH FT source 1..750 FT /organism="Cucurbit chlorotic yellows virus" FT /host="Cucumis melo" FT /mol_type="genomic RNA" FT /country="Sudan" FT /collected_by="K. Hamed" FT /collection_date="Jun-2010" FT /db_xref="taxon:558690" FT CDS 1..>750 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:G4XGN2" FT /db_xref="InterPro:IPR002679" FT /db_xref="UniProtKB/TrEMBL:G4XGN2" FT /protein_id="AEP04458.1" FT /translation="MEKTDNKQNDDLNKITEDGAEVIERYEKRESEGSKSSSNYEVRDL FT ITPEHMNPEKLGDIVVYSNRADVMTEEDELKFEQCMRDFAKKFVFKKSDSEPSPDEFMA FT FYVSLVQSWLTQSTSMKNARQRNLSNTLSVKNQKYTWRTAEFIDFVKGNLPHVPNPFRQ FT YARKHESDIEIPKATGKVMSDHHLQAKHGVLSQYWALPADYVNGSLINISDDDLAANLL FT MKCQALKGTSQERKFYNVSQSAPGGCSK" XX SQ Sequence 750 BP; 268 A; 123 C; 176 G; 183 T; 0 other; atggagaaga ctgacaataa acaaaatgat gatttgaaca agataactga ggatggagcc 60 gaagttattg aaaggtatga aaagagagaa agcgaggggt cgaaaagttc aagcaactat 120 gaagtaagag atttgatcac acccgaacac atgaatcctg aaaaattggg agacatagtt 180 gtttattcaa atagggcaga tgtgatgaca gaggaagatg aactcaaatt cgaacagtgt 240 atgagggatt tcgcgaagaa gtttgttttt aagaaatctg actctgaacc atcaccagac 300 gagttcatgg ctttctatgt gagtttggtt caaagttggt tgacacaaag cacatcaatg 360 aaaaatgcgc ggcagaggaa tttgtcaaac acattatcag taaaaaatca aaaatacacc 420 tggaggacag ctgaattcat tgattttgtg aagggaaatc taccacatgt tccgaaccct 480 ttcagacaat atgccaggaa acacgagtca gatattgaaa ttcctaaagc cactggtaag 540 gtaatgagcg accatcatct acaggcaaaa cacggtgtct tatcacaata ttgggcttta 600 ccggctgatt acgttaatgg ttctttgata aacatctcag atgatgattt ggcggcaaac 660 ttgctgatga agtgccaagc tctgaaagga acaagtcagg aaagaaaatt ctataacgtg 720 tctcagtcgg caccgggagg ttgtagtaaa 750 //