ID J02096; SV 1; linear; viral cRNA; STD; VRL; 1096 BP. XX AC J02096; XX DT 13-JUN-1985 (Rel. 06, Created) DT 16-JUL-2016 (Rel. 129, Last updated, Version 5) XX DE Influenza B virus (B/Lee/1940) segment 8, complete sequence. XX KW nonstructural protein. XX OS Influenza B virus (B/Lee/1940) OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Insthoviricetes; OC Articulavirales; Orthomyxoviridae; Betainfluenzavirus. XX RN [1] RP 6-150 RX DOI; 10.1016/0042-6822(80)90188-9. RX PUBMED; 7385583. RA Air G.M., Hackett J.A.; RT "Gene 8 of influenza virus: sequences of cDNA transcribed from the 3' ends RT of viral RNA of influenza A and B strains"; RL Virology 103(2):291-298(1980). XX RN [2] RP 1-1096 RX PUBMED; 6283137. RA Briedis D.J., Lamb R.A.; RT "Influenza B virus genome: sequences and structural organization of RNA RT segment 8 and the mRNAs coding for the NS1 and NS2 proteins"; RL J. Virol. 42(1):186-193(1982). XX DR MD5; 2cbb7337ee5b46d80980fe7b60cdc8da. XX CC No antigenicity (sub-type) specified. viral RNA sequence determined CC by analysis of fragments of cDNA (synthesized with polyadenylated CC vRNA) cloned (pbn27) in pbr322. NS-2 mRNA sequence determined by CC analysis of cDNA fragment (from above clone) primer. Coding regions CC and introns assigned by consideration of open reading frames, CC comparison of predicted MW with experimentally determined MW, CC comparison to the coding regions of segment 8 in other influenza CC strains and consideration of consensus splice sites. The influenza CC genome is single-stranded RNA, and minus-stranded. The sequence CC reported below is the + strand. XX FH Key Location/Qualifiers FH FT source 1..1096 FT /organism="Influenza B virus (B/Lee/1940)" FT /segment="8" FT /strain="B/Lee/1940" FT /mol_type="viral cRNA" FT /db_xref="taxon:518987" FT CDS join(43..75,731..1066) FT /codon_start=1 FT /product="nonstructural protein NS-2" FT /db_xref="GOA:P03511" FT /db_xref="InterPro:IPR000968" FT /db_xref="UniProtKB/Swiss-Prot:P03511" FT /protein_id="AAA43755.1" FT /translation="MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWE FT SYPNLVKSTDYHQKRETIRLATEELYLLSKRIDDSILFHKTVIANSSIIADMIVSLSLL FT ETLYEMKDVVEVYSRQCL" FT CDS 43..888 FT /codon_start=1 FT /product="nonstructural protein NS-1" FT /db_xref="GOA:P03502" FT /db_xref="InterPro:IPR004208" FT /db_xref="InterPro:IPR009068" FT /db_xref="PDB:1XEQ" FT /db_xref="PDB:3R66" FT /db_xref="PDB:3RT3" FT /db_xref="PDB:3SDL" FT /db_xref="UniProtKB/Swiss-Prot:P03502" FT /protein_id="AAA43756.1" FT /translation="MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQ FT DRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPYC FT VKNPSTSKCPNYDWTDYPPTPGKYLDDIEEEPENVDHPIEVVLRDMNNKDARQKIKDEV FT NTQKEGKFRLTIKRDIRNVLSLRVLVNGTFLKHPNGDKSLSTLHRLNAYDQNGGLVAKL FT VATDDRTVEDEKDGHRILNSLFERFDEGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN FT " XX SQ Sequence 1096 BP; 382 A; 199 C; 254 G; 261 T; 0 other; cgcagaagca gaggatttat ttagtcactg gcaaacggaa agatggcgga caacatgacc 60 acaacacaaa ttgaggtggg tccgggagca accaatgcca ctataaactt tgaagcagga 120 attctggagt gctatgaaag gttttcatgg caaagagccc ttgactatcc tggtcaagac 180 cgcctacaca gactaaaacg aaaattagaa tcaagaataa agactcacaa caagagtgag 240 cctgagaata aaaggatgtc tcttgaagag agaaaagcaa ttggggtaaa aatgatgaaa 300 gtgcttctgt ttatggatcc ctctgctgga attgaagggt ttgagccata ctgtgtgaaa 360 aatccctcaa ctagcaaatg tccaaattac gattggaccg attaccctcc aaccccagga 420 aagtaccttg atgacataga agaagagccg gaaaatgtcg atcacccaat tgaggtagta 480 ttaagggaca tgaacaataa agatgcacga caaaagataa aggatgaagt aaacactcag 540 aaagagggga aattccgttt gacaataaaa agggatatac gtaatgtgtt gtccttgaga 600 gtgttggtga acggaacctt cctcaagcac cctaatggag acaagtcctt atcaactctt 660 catagattga atgcatatga ccagaatgga gggcttgttg ctaaacttgt tgctactgat 720 gatcggacag tggaggatga aaaagatggc catcggatcc tcaactcact cttcgagcgt 780 tttgatgaag gacattcaaa gccaattcga gcagctgaaa ctgcggtggg agtcttatcc 840 caatttggtc aagagcaccg attatcacca gaagagggag acaattagac tggccacgga 900 agaactttat ctcttgagta aaagaattga tgatagtata ttgttccaca aaacagtaat 960 agctaacagc tccataatag ctgacatgat tgtatcatta tcattactgg aaacattgta 1020 tgaaatgaag gatgtggttg aagtgtacag caggcagtgc ttatgaatgt aaaataaaaa 1080 tcctcttgtt actact 1096 //