ID HQ844092; SV 1; linear; genomic RNA; STD; VRL; 945 BP. XX AC HQ844092; XX DT 07-JUN-2011 (Rel. 109, Created) DT 27-FEB-2013 (Rel. 115, Last updated, Version 4) XX DE Sweet potato feathery mottle virus isolate Hubei7 coat protein gene, DE partial cds. XX KW . XX OS Sweet potato feathery mottle virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-945 RX DOI; 10.1007/s00705-012-1503-8. RX PUBMED; 23053527. RA Qin Y., Zhang Z., Qiao Q., Zhang D., Tian Y., Wang Y.; RT "Molecular variability of sweet potato chlorotic stunt virus (SPCSV) and RT five potyviruses infecting sweet potato in China"; RL Arch. Virol. 158(2):491-495(2013). XX RN [2] RP 1-945 RA Qin Y.H., Zhang Z.C., Qiao Q., Zhang D.S., Tian Y.T., Wang Y.J.; RT ; RL Submitted (29-DEC-2010) to the INSDC. RL Institute of Plant Protection, Henan Academy of Agricultural Sciences, 1 RL Nongye Road, Zhengzhou, Henan 450002, China XX DR MD5; d5e186796466d06b1236208d64fa6c95. XX FH Key Location/Qualifiers FH FT source 1..945 FT /organism="Sweet potato feathery mottle virus" FT /host="Ipomoea batatas" FT /isolate="Hubei7" FT /mol_type="genomic RNA" FT /country="China" FT /collection_date="Aug-2009" FT /db_xref="taxon:12844" FT CDS <1..>945 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:F8TCE7" FT /db_xref="InterPro:IPR001592" FT /db_xref="UniProtKB/TrEMBL:F8TCE7" FT /protein_id="AEG79928.1" FT /translation="SNESTEFKDAGANPPAPKPKDIPPPPTITEVTDPEDPKQAALRAA FT RAKQPATIPESYGRDTSKEKESIVGASSKGVRDKDVNAGTVGTFVVPRVKMNANKKRQP FT MVNGRAIINFQHLSTYEPELFEVANTRSTQEQFQAWYKGVKGDYGVDDTGMGILLNGLM FT VWCIENGTSPNINGVWTMMDGDEQVTYPIKPLLDHAVPTFRQIMTHFSDVAEAYIEMRN FT RTKAYMPRYGLQRNLTDMSLARYAFDFYELHSTTPARAKEAHLQMKAAAPKNAKNRLFG FT LDGNVSTQEEDTERHTTTDVTRNIHNLLGMRGVQ" XX SQ Sequence 945 BP; 308 A; 185 C; 238 G; 214 T; 0 other; tctaatgaga gtactgaatt taaagatgcg ggagcgaatc ctccagcccc taagcctaag 60 gatatccctc caccacccac aataactgag gttactgatc cagaagaccc aaagcaggca 120 gctttgagag ctgcacgagc taagcaaccc gcaaccattc cagaatcata tggacgagac 180 acaagcaagg agaaggaatc aatagtgggg gcatcatcaa agggtgtgag ggataaagat 240 gtaaacgctg gtacagttgg tacgtttgtc gtgccacgtg ttaagatgaa tgcaaacaag 300 aaaaggcaac caatggtaaa cggaagagcc attataaatt tccaacactt gtcaacatat 360 gagccagaac tgtttgaggt tgcaaacacc cggtcgactc aagaacagtt tcaagcatgg 420 tataagggag tgaaagggga ctatggtgtt gatgatacag gaatggggat cttattgaat 480 ggattaatgg tttggtgcat tgaaaatggc acatccccaa atataaatgg tgtgtggact 540 atgatggatg gtgatgagca agtgacatat ccaattaaac cattgttgga ccatgcagtg 600 cctactttta ggcagattat gacgcacttc agtgacgttg ctgaagctta catagagatg 660 cgaaaccgta caaaggcgta catgccaagg tatggtctac aacgtaattt gactgatatg 720 agtcttgcgc gatatgcatt tgatttctac gagctgcatt caactacccc tgcacgtgca 780 aaagaagcac atttacagat gaaggcagcc gcgcccaaga atgcgaaaaa tcggttgttt 840 ggtttggacg gaaacgtctc cacgcaagaa gaagatacgg agaggcacac gacaactgat 900 gttactagaa atatacataa cctcttagga atgaggggtg tgcaa 945 //