ID HQ728368; SV 1; linear; viral cRNA; STD; VRL; 834 BP. XX AC HQ728368; XX DT 01-APR-2011 (Rel. 108, Created) DT 10-APR-2013 (Rel. 116, Last updated, Version 3) XX DE Soybean vein necrosis virus isolate IL5 nucleocapsid protein gene, complete DE cds. XX KW . XX OS Soybean vein necrosis virus OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Ellioviricetes; OC Bunyavirales; Tospoviridae; Orthotospovirus; OC Soybean vein necrosis orthotospovirus. XX RN [1] RC Publication Status: Available-Online prior to print RP 1-834 RX DOI; 10.1094/PHYTO-12-12-0322-R. RX PUBMED; 23550970. RA Zhou J., Tzanetakis I.; RT "Epidemiology of Soybean vein necrosis-associated virus"; RL Phytopathology 103(9):966-971(2013). XX RN [2] RP 1-834 RA Zhou J., Tzanetakis I.E.; RT ; RL Submitted (18-DEC-2010) to the INSDC. RL Department of Plant Pathology, Cell and Molecular Biology Program, RL University of Arkansas, Plant Pathology-Plant Sciences Building, 495 N. RL Campus Drive, Room 217, Fayetteville, AR 72701, USA XX DR MD5; 8e28e9a78e47f7187f22e5c003e20bf4. XX FH Key Location/Qualifiers FH FT source 1..834 FT /organism="Soybean vein necrosis virus" FT /host="soybean" FT /isolate="IL5" FT /mol_type="viral cRNA" FT /country="USA" FT /collection_date="Jun-2010" FT /db_xref="taxon:980895" FT CDS 1..834 FT /codon_start=1 FT /product="nucleocapsid protein" FT /db_xref="GOA:F2Y3K4" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:F2Y3K4" FT /protein_id="ADX96045.1" FT /translation="MPQTAGPSNAKPVKLTESNLARLLKFEEDIEFEKNSTGFKFSEFY FT KTHMGRKFRYASALTFLKNRKAIVNMCKKGTFNFDGQTVKLSVESGDDNSFTFKRLDSF FT LRVKMLEHNFAVFDGTNEEAKQSLCNDLATIPLVQAYGLTVKDKMSAKLAIMIGGSLPL FT LASITGCEAYCFGLAIFQDLKKEQLGIVNFDTKAQAAKVASVLDAKGFKFTEEKNQTLR FT LIAEILKDMAPQMRGVASLEKYNEQIGIISDIIGVHFEMPGKKDGKGKKSKEFSV" XX SQ Sequence 834 BP; 284 A; 149 C; 185 G; 216 T; 0 other; atgccacaaa cagcaggacc aagcaatgca aaaccagtga agctcactga gtcaaaccta 60 gcaaggcttc tcaaatttga agaagacata gaatttgaga aaaacagcac aggattcaag 120 ttcagcgagt tctacaaaac ccacatgggt cgcaaattca ggtacgcatc tgcattgacc 180 tttctcaaaa acagaaaggc tattgtcaac atgtgcaaaa aagggacatt taattttgac 240 ggacaaactg ttaaattgtc tgtagagagt ggtgatgaca atagcttcac ttttaaaaga 300 ctggatagct ttttgagagt gaagatgctt gaacacaatt ttgcagtttt tgatggaaca 360 aatgaagagg ctaaacaaag cttgtgcaat gatttagcaa ccatcccact tgtgcaagct 420 tatggtctga ctgtgaaaga taagatgtca gcaaagcttg ccataatgat tggtggaagc 480 ttaccccttc tggcatcaat cacaggttgt gaagcctatt gttttggttt agctatcttt 540 caggacctaa agaaagaaca gcttggtatt gtcaactttg acacaaaggc tcaagctgct 600 aaagttgcat ctgtgctgga tgcaaagggc tttaaattca ctgaagagaa aaatcaaact 660 ctcaggctga ttgctgagat actgaaggac atggcacccc aaatgagagg agttgcatcc 720 cttgagaagt acaatgaaca gattggaatc atttctgata tcattggggt ccattttgaa 780 atgcctggaa agaaagatgg aaaaggcaag aaatcaaagg agttttctgt ttaa 834 //