ID HQ171920; SV 1; linear; genomic RNA; STD; VRL; 424 BP. XX AC HQ171920; XX DT 15-MAR-2011 (Rel. 108, Created) DT 15-MAR-2011 (Rel. 108, Last updated, Version 1) XX DE Potato mop-top virus isolate Capellania triple gene block protein 2 (TGBp2) DE gene, complete cds. XX KW . XX OS Potato mop-top virus OC Viruses; Riboviria; Virgaviridae; Pomovirus. XX RN [1] RP 1-424 RA Gil J.F., Marin M.A., Cotes J.M.; RT "Molecular variation of Colombian PMTV isolates"; RL Unpublished. XX RN [2] RP 1-424 RA Gil J.F., Marin M.A., Cotes J.M.; RT ; RL Submitted (24-AUG-2010) to the INSDC. RL Faculty of Sciences, School of Biosciences, National University of RL Colombia, Carrera 65 X Calle 64, Medellin, Antioquia, Colombia XX DR MD5; 8aa6f5aef24a2c1cef315683872d1844. XX FH Key Location/Qualifiers FH FT source 1..424 FT /organism="Potato mop-top virus" FT /host="Nicotiana benthamiana" FT /isolate="Capellania" FT /mol_type="genomic RNA" FT /country="Colombia:Boyaca, Ventaquemada-Capellania" FT /isolation_source="roots" FT /db_xref="taxon:37128" FT gene 23..388 FT /gene="TGBp2" FT CDS 23..388 FT /codon_start=1 FT /gene="TGBp2" FT /product="triple gene block protein 2" FT /note="tgbp2; cell to cell movement" FT /db_xref="GOA:F2WNL9" FT /db_xref="InterPro:IPR001896" FT /db_xref="UniProtKB/TrEMBL:F2WNL9" FT /protein_id="ADZ38937.1" FT /translation="MVRNNEIGARPNQYWPVVAAVVAICLFGFLTLTNQKHATQSGDNI FT HKFANGGQYRDGSKSIKYNCNNPRAYNGSSSNNTFSQLFLPVLLLGAALYAYLWFTRPD FT CSVTCRGDCCKNYGGQQ" XX SQ Sequence 424 BP; 119 A; 93 C; 95 G; 117 T; 0 other; cagcaaccac aaacagacag gtatggtccg gaataacgaa attggagcgc gaccaaacca 60 atattggccg gtagttgcgg cggtagtagc tatttgtctt ttcgggtttt taacgttaac 120 caatcaaaaa cacgctactc agtctggtga taacattcat aagtttgcta acggtggtca 180 atatagagac ggttcaaaaa gtattaagta taattgtaat aatcctagag catacaatgg 240 atcctccagt aataatacat tctcccaact gttcttgcca gtattgctcc tcggagctgc 300 cctctacgca tacctgtggt tcacaagacc cgattgctca gtcacatgca ggggggattg 360 ctgcaagaat tacgggggcc aacagtgagt acttttcttt gccgtacgtg ttgttagttg 420 ctac 424 //