ID HQ171919; SV 1; linear; genomic RNA; STD; VRL; 418 BP. XX AC HQ171919; XX DT 15-MAR-2011 (Rel. 108, Created) DT 15-MAR-2011 (Rel. 108, Last updated, Version 1) XX DE Potato mop-top virus isolate Vallejuelito triple gene block protein 2 DE (TGBp2) gene, complete cds. XX KW . XX OS Potato mop-top virus OC Viruses; Riboviria; Virgaviridae; Pomovirus. XX RN [1] RP 1-418 RA Gil J.F., Marin M.A., Cotes J.M.; RT "Molecular variation of Colombian PMTV isolates"; RL Unpublished. XX RN [2] RP 1-418 RA Gil J.F., Marin M.A., Cotes J.M.; RT ; RL Submitted (24-AUG-2010) to the INSDC. RL Faculty of Sciences, School of Biosciences, National University of RL Colombia, Carrera 65 X Calle 64, Medellin, Antioquia, Colombia XX DR MD5; a7b97ab07ccddc24baaf21bdd27fb9f6. XX FH Key Location/Qualifiers FH FT source 1..418 FT /organism="Potato mop-top virus" FT /host="Nicotiana benthamiana" FT /isolate="Vallejuelito" FT /mol_type="genomic RNA" FT /country="Colombia:Antioquia, La Union-Vallejuelito" FT /isolation_source="roots" FT /db_xref="taxon:37128" FT gene 23..382 FT /gene="TGBp2" FT CDS 23..382 FT /codon_start=1 FT /gene="TGBp2" FT /product="triple gene block protein 2" FT /note="tgbp2; cell to cell movement" FT /db_xref="GOA:Q80QA2" FT /db_xref="InterPro:IPR001896" FT /db_xref="UniProtKB/TrEMBL:Q80QA2" FT /protein_id="ADZ38936.1" FT /translation="MVRNNEIGARPNKYWPVVAAVVAICLFGFLTVTNQKHATQSGDNI FT HKFANGGQYRDGSKSIKYNCNNPRAYNGSSSNNTFSQLFLPVLLIGAALYAYLWFTRPD FT CSVTCRGDCCRSYGS" XX SQ Sequence 418 BP; 121 A; 85 C; 89 G; 123 T; 0 other; cagcaaccac aaacagacag gtatggtccg gaataacgaa attggagcgc gaccaaataa 60 atattggccg gtagttgcgg cagtagttgc tatttgtctt ttcggttttt taacagttac 120 caatcaaaaa cacgctactc aatcaggtga taatatacat aaatttgcta acggtggcca 180 gtacagggac ggttctaaga gtattaagta taattgtaac aatcccagag cttataatgg 240 atcctccagt aataatacat tctcccaatt gttcttgcca gttttgctca tcggagctgc 300 cctctacgca tacttgtggt tcacaagacc ggactgttcc gtcacatgta gaggcgactg 360 ctgcaggtca tatggaagct aaaaattttt ctttgcagta tgttttgtta gtggctaa 418 //