ID HQ154131; SV 1; linear; genomic RNA; STD; VRL; 825 BP. XX AC HQ154131; XX DT 07-MAR-2011 (Rel. 108, Created) DT 10-MAR-2011 (Rel. 108, Last updated, Version 2) XX DE Tomato yellow ring virus strain TYRV-t nucleocapsid protein (N) gene, DE complete cds. XX KW . XX OS Tomato yellow ring virus OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Ellioviricetes; OC Bunyavirales; Tospoviridae; unclassified Tospoviridae. XX RN [1] RP 1-825 RA Beikzadeh N., Jafarpour B., Rohani H., Kormelink R., Peters D., RA Hassani-Mehraban A.; RT "Tomato yellow ring virus (TYRV-t) infecting tomato in Northern Khorasan RT Province, Bojnourd, Iran"; RL Unpublished. XX RN [2] RP 1-825 RA Beikzadeh N., Jafarpour B., Rohani H.; RT ; RL Submitted (18-AUG-2010) to the INSDC. RL Department of Plant Protection, College of Agriculture, Ferdowsi University RL of Mashhad, Mashhad, Iran XX RN [3] RP 1-825 RA Kormelink R., Peters D., Hassani-Mehraban A.; RT ; RL Submitted (18-AUG-2010) to the INSDC. RL Laboratory of Virology, Wageningen University, Droevendaalsesteeg 1, RL Wageningen 6708PB, The Netherlands XX DR MD5; 1861afcab026843f0ba04ee0a8d9fbcd. XX FH Key Location/Qualifiers FH FT source 1..825 FT /organism="Tomato yellow ring virus" FT /host="Solanum lycopersicum" FT /strain="TYRV-t" FT /mol_type="genomic RNA" FT /country="Iran:Northern Khorasan Province, Bojnourd" FT /isolation_source="leaf" FT /collection_date="22-Oct-2009" FT /db_xref="taxon:304859" FT gene complement(1..825) FT /gene="N" FT CDS complement(1..825) FT /codon_start=1 FT /gene="N" FT /product="nucleocapsid protein" FT /db_xref="GOA:F1BXA8" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:F1BXA8" FT /protein_id="ADY75570.1" FT /translation="MATARVSKENIEKLLAGGEADVVIEAEETAGFNFKEFVLANKAMK FT MTFNNGYTILRNRAGIYKMVKAGQFKFQGNPIIVPGATVSAGQDDWTFRRLEGFIRAKM FT FMELIAVENASEQQKMYEKLCELPMVNAYGLKPSPKFDATTARVMLTLGGPLPLMASLD FT KFAATAFPLAYFQNVKKETLGISKFSTYEQLCKIARVMATKEFTFTGVSKDIFEETIKI FT LNDCTPGTAGAASLNKFNEQIKALESAFGKIVDDNGAGSSKPKPSSKKNDAF" XX SQ Sequence 825 BP; 223 A; 183 C; 147 G; 272 T; 0 other; ttaaaatgca tcgttctttt tggaggatgg tttaggtttt gaagacccag caccattatc 60 atcaacaatt ttcccaaaag cactttcaag agctttaatt tgttcattga acttattcaa 120 tgaagcagca ccagcagttc ctggagtaca gtcattgaga atttttatgg tttcttcaaa 180 aatgtctttg gaaaccccag tgaaagtgaa ttctttagtt gccataactc gggcaatctt 240 gcacagctgt tcataagttg aaaatttgct tattcccaaa gtttcctttt tcacattctg 300 gaaataagcc aatggaaatg cagtagcagc aaatttatca agacttgcca tcaaggggag 360 agggcctcct agtgtcagca tgactctagc tgtagttgca tcaaatttag ggctaggttt 420 taaaccatat gcgtttacca ttggaagctc acaaagtttt tcatacattt tctgctgctc 480 gcttgcattc tccacagcaa tcagttccat gaacattttg gctcttatga agccttccaa 540 ccttctgaat gtccaatcat cttgaccagc gctcacagtt gcaccgggaa caataatagg 600 attgccttgg aatttaaact ggcctgcttt caccattttg taaatacctg ctctgttcct 660 taaaattgtg taaccgttgt tgaatgtcat tttcatggct ttgttagcca aaacaaactc 720 tttgaagttg aatcctgcag tttcttcagc ttcaatcact acatctgctt caccaccagc 780 aagaagcttc tcaatgttct ctttgctcac tcgtgcggta gccat 825 //