ID HQ123182; SV 1; linear; genomic RNA; STD; VRL; 341 BP. XX AC HQ123182; XX DT 01-FEB-2011 (Rel. 107, Created) DT 03-FEB-2011 (Rel. 107, Last updated, Version 2) XX DE Shallot latent virus isolate Sao Manuel 2/SP TGB2 gene, partial cds; and DE TGB3 gene, complete cds. XX KW . XX OS Shallot latent virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-341 RX DOI; .1094/PDIS-08-10-0599. RX PUBMED; 30743437. RA Mituti T., Marubayashi J.M., Moura M.F., Krause-Sakate R., Pavan M.A.; RT "First Report of Shallot latent virus in Garlic in Brazil"; RL Plant Dis. 95(2):227-227(2011). XX RN [2] RP 1-341 RA Mituti T., Marubayashi J.M., Moura M.F., Krause-Sakate R., Pavan M.A.; RT ; RL Submitted (11-AUG-2010) to the INSDC. RL Plant Protection, UNESP/FCA, Rua Jose Barbosa de Barros, 1780, Botucatu, SP RL 18610307, Brazil XX DR MD5; 15029768c2676faeea9a6cbfae41fe51. XX FH Key Location/Qualifiers FH FT source 1..341 FT /organism="Shallot latent virus" FT /host="garlic" FT /isolate="Sao Manuel 2/SP" FT /mol_type="genomic RNA" FT /country="Brazil" FT /collection_date="02-Jul-2008" FT /db_xref="taxon:12172" FT CDS <1..151 FT /codon_start=2 FT /product="TGB2" FT /function="movement cell to cell of the virus" FT /note="ORF 3" FT /db_xref="GOA:E9LRT9" FT /db_xref="UniProtKB/TrEMBL:E9LRT9" FT /protein_id="ADW08676.1" FT /translation="PARNFPSSNLLLNFTSPVLLLGIIIGLICLSEKFRPSSRTHITCS FT CNHS" FT CDS 130..324 FT /codon_start=1 FT /product="TGB3" FT /function="movement cell to cell of the virus" FT /note="ORF 4" FT /db_xref="GOA:E9LRT8" FT /db_xref="InterPro:IPR003411" FT /db_xref="UniProtKB/TrEMBL:E9LRT8" FT /protein_id="ADW08677.1" FT /translation="MQLQPLVALIIGLSVTLIICFTFDSVRTERCTVIITGESVKFLGC FT EFTRDFIDFAIQAKPFGSL" XX SQ Sequence 341 BP; 90 A; 74 C; 68 G; 109 T; 0 other; tccggccagg aacttcccaa gcagtaattt gctactgaac ttcacttccc ctgtcctttt 60 actaggaatt ataataggcc taatttgctt gagcgaaaaa tttaggccca gctcgcgaac 120 gcacattaca tgcagttgca accactcgta gccctaataa taggtctttc tgtaacgctg 180 attatttgct ttactttcga tagcgtaaga actgagcggt gtactgttat tattactggg 240 gaatcggtca aatttctggg gtgtgaattc actagggatt tcatagattt tgccatacaa 300 gctaaacctt ttggttcact ttaggttaac agcgctctaa a 341 //