ID HM543474; SV 1; linear; genomic RNA; STD; VRL; 703 BP. XX AC HM543474; XX DT 13-SEP-2010 (Rel. 106, Created) DT 19-NOV-2010 (Rel. 106, Last updated, Version 2) XX DE Great Island virus isolate CanAr 42 segment 10, complete sequence. XX KW . XX OS Great Island virus OC Viruses; Riboviria; Reoviridae; Sedoreovirinae; Orbivirus. XX RN [1] RP 1-703 RX DOI; 10.1099/vir.0.024760-0. RX PUBMED; 20739272. RA Belhouchet M., Mohd Jaafar F., Tesh R.B., Grimes J., Maan S., RA Mertens P.P.C., Attoui H.; RT "Complete sequence of Great Island virus and comparison with the T2 and RT outer-capsid proteins of Kemerovo, Lipovnik and Tribec viruses (genus RT Orbivirus, family Reoviridae)"; RL J. Gen. Virol. 91(Pt 12):2985-2993(2010). XX RN [2] RP 1-703 RA Belhouchet M., Mohd Jaafar F., Mertens P.P.C., Attoui H.; RT ; RL Submitted (14-JUN-2010) to the INSDC. RL Vector-Borne Diseases, Institute for Animal Health, Ash Road, Woking, RL Surrey GU24 0NF, United Kingdom XX DR MD5; 70a3ed79911eb0e8210bdefba8033ff6. XX FH Key Location/Qualifiers FH FT source 1..703 FT /organism="Great Island virus" FT /segment="10" FT /isolate="CanAr 42" FT /mol_type="genomic RNA" FT /country="Canada" FT /db_xref="taxon:204269" FT CDS 146..661 FT /codon_start=1 FT /product="NS3" FT /db_xref="GOA:E1AA99" FT /db_xref="UniProtKB/TrEMBL:E1AA99" FT /protein_id="ADM88602.1" FT /translation="MKNEKAAYGAASEVLKDDETTRMLKMQVNECSLTEMRQTYQSLKR FT RCRLLYYGELLCLAAALGLTLVLMVPSASRVLEGALTQANITGHVITGILTSLAIFLQH FT HRARLLKRKRSIKRDIVKRMTYISLARRMGSQFPESAGAGSDFRARLMALAEEAERARD FT DSDWRRWP" XX SQ Sequence 703 BP; 160 A; 188 C; 217 G; 138 T; 0 other; gtaaaaatct tccaacgatg ctagctgcac ttgagatgaa gtcgtcacca actgccccac 60 ccgctccgcg gcgatcccca gtgctaacgt cgccctgagt gtcttacaaa atgctgtcgc 120 ttccggaaca ggggcgaacg agacaatgaa gaatgagaag gcggcatatg gggcggcttc 180 tgaggttctg aaagacgacg agacgacgcg tatgctcaag atgcaggtga acgaatgcag 240 tcttacggag atgcgccaga catatcagag tctgaagagg cgttgccgac tgctttatta 300 tggagagttg ctgtgtctag ctgcggcttt aggactcaca ctcgtcctga tggtcccatc 360 cgcgtcgagg gtcttggagg gcgcgctcac ccaggctaac atcacgggtc acgtgataac 420 cggaatcctt acgagccttg cgatcttcct gcaacaccac cgagcgcggc tgctgaagcg 480 gaagcgcagc attaaacgtg acatcgtgaa gcgcatgacc tacatctccc tcgcccgcag 540 gatgggatcg cagtttccgg aaagcgctgg cgcaggaagt gactttaggg ctcgtctcat 600 ggcgctagcg gaggaagcgg aacgtgccag ggatgacagc gactggcggc gctggcccta 660 ggtgcgggca cctcgcgatg gtgttgccgg gagattagga tac 703 //