ID HM538370; SV 1; linear; genomic RNA; STD; VRL; 336 BP. XX AC HM538370; XX DT 31-OCT-2010 (Rel. 106, Created) DT 31-OCT-2010 (Rel. 106, Last updated, Version 1) XX DE Cucumber mosaic virus isolate WXM-1 2b protein (2b) gene, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-336 RA Wang X., Liu Z.; RT ; RL Submitted (13-JUN-2010) to the INSDC. RL Chinese Academy of Tropical Agricultural Science, Institute of Tropical RL Bioscience and Biotechnology, 4# College Road, Longhua District, Haikou, RL Hai 571101, China XX DR MD5; 816eac319f5b72ef9a22b22f95265d9d. XX FH Key Location/Qualifiers FH FT source 1..336 FT /organism="Cucumber mosaic virus" FT /segment="RNA 2" FT /host="banana" FT /isolate="WXM-1" FT /mol_type="genomic RNA" FT /country="China" FT /collection_date="15-May-2009" FT /note="subgroup: I" FT /db_xref="taxon:12305" FT gene 1..336 FT /gene="2b" FT CDS 1..336 FT /codon_start=1 FT /gene="2b" FT /product="2b protein" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:E3UPX8" FT /protein_id="ADP02159.1" FT /translation="MELNEGAATNVELQLARMLEVKRQRRKSHKMNRRERGHKSPSERA FT RSNLRLFRFLPFYQVDGSELMEMHRHVNVAKSSESEAPRVTLPVEEDHDFDDTDWFAGN FT ECAEGAF" XX SQ Sequence 336 BP; 89 A; 74 C; 100 G; 73 T; 0 other; atggaattga acgaaggcgc agcgacaaac gtcgaactcc agctggctcg tatgttggag 60 gtgaagagac agagacgaaa gtctcacaag atgaatcgac gggaacgagg tcacaaaagt 120 cccagcgaga gggcgcgttc aaatctcaga cttttccgct tcctaccttt ctatcaagta 180 gatggttcgg aactgatgga gatgcaccgc cacgtgaacg tggcgaaatc ctccgagtct 240 gaggcccctc gtgttacgtt accggtggaa gaagaccatg attttgacga tacggattgg 300 ttcgctggta acgagtgtgc ggaaggtgcg ttttga 336 //