ID HM036201; SV 1; linear; genomic RNA; STD; VRL; 801 BP. XX AC HM036201; XX DT 13-MAY-2010 (Rel. 104, Created) DT 13-MAY-2010 (Rel. 104, Last updated, Version 1) XX DE Potato virus Y isolate Ur2-PVYCP2 coat protein gene, partial cds. XX KW . XX OS Potato virus Y OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-801 RA Dong D.X., Luo M.; RT "Simultaneous detection of multiple potato viruses isolated from Xinjiang RT with one-step multiplex RT-PCR"; RL Unpublished. XX RN [2] RP 1-801 RA Dong D.X., Luo M.; RT ; RL Submitted (16-MAR-2010) to the INSDC. RL Plant Pathology, College of Agronomy, Xinjiang Agriculture University, RL Urumqi 830052, China XX DR MD5; 2e190410982dd112f7b1c2f13a2909ce. XX FH Key Location/Qualifiers FH FT source 1..801 FT /organism="Potato virus Y" FT /host="potato cv. Ur2" FT /isolate="Ur2-PVYCP2" FT /mol_type="genomic RNA" FT /country="China" FT /collection_date="2009" FT /db_xref="taxon:12216" FT CDS <1..>801 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:D6R1N5" FT /db_xref="InterPro:IPR001592" FT /db_xref="UniProtKB/TrEMBL:D6R1N5" FT /protein_id="ADG36598.1" FT /translation="ANDTIDAGESNKKDAKPEQGSIQPNPNKGKDKDVNAGTSGTHTVP FT RIKAITSKMRMPKSKGATVLNLEHLLEYAPQQIDISNTRATQSQFDTWYEAVRMAYDIG FT ETGMPTVMNGLMVWCIENGTSPNVNGVWVMMDGNEQVEYPLKPIVENAKPTLRQIMAHF FT SDVAEAYIEMRNKKEPYMPRYGLIRNLRDVGLARYAFDFYEVTSRTPVRAREAHIQMKA FT AALKSAQPRLFGLDGGISTQEENTERHTTEDVSPSMHTLLGVKNM" XX SQ Sequence 801 BP; 271 A; 166 C; 200 G; 164 T; 0 other; gcaaatgaca caattgatgc aggagaaagc aacaagaaag atgcaaaacc agagcaaggc 60 agcatccagc caaacccgaa caaaggaaaa gataaggatg tgaatgctgg tacatctggg 120 acacatactg tgccgagaat caaggctatc acgtccaaaa tgagaatgcc caaaagcaag 180 ggagcaaccg tgctaaactt ggaacatttg ctcgagtatg ctccacaaca aattgatatt 240 tcaaacacta gggcaactca atcacagttt gatacgtggt atgaggcagt gcggatggca 300 tacgacatag gagaaactgg gatgccaact gtgatgaatg ggcttatggt ttggtgcatc 360 gaaaatggaa cctcgccaaa tgtcaacgga gtttgggtta tgatggatgg gaatgaacaa 420 gttgaatacc cgttgaaacc aatcgttgag aatgcaaaac caacccttag gcaaatcatg 480 gcacatttct cagatgttgc agaagcgtat atagaaatgc gcaataaaaa ggaaccatat 540 atgccacgat atggtttaat ccgaaatctg cgggatgtag gtttagcgcg ctatgccttc 600 gacttttatg aggtcacatc acgaacacca gtgagggcta gggaagcgca cattcaaatg 660 aaggccgcag cattgaaatc agcccaacct cgacttttcg ggttggacgg tggcatcagt 720 acacaagagg agaacacaga gaggcacacc accgaggatg tctctccaag tatgcatact 780 ctacttggag tcaagaacat g 801 //