ID HE971595; SV 1; linear; genomic RNA; STD; VRL; 539 BP. XX AC HE971595; XX DT 25-NOV-2012 (Rel. 114, Created) DT 25-NOV-2012 (Rel. 114, Last updated, Version 1) XX DE Cucumber mosaic virus partial ORF2a gene and ORF2b gene, segment RNA2, DE genomic RNA, isolate KO47/96 XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-539 RA Jacquemond M.; RT ; RL Submitted (26-JUL-2012) to the INSDC. RL INRA, Station de Pathologie Vegetale, Domaine Saint Maurice, BP 9484143 RL Montfavet Cedex, FRANCE. XX RN [2] RA Ben Tamarzizt H., Montarry J., Girardot G., Fakhfakh H., Tepfer M., RA Jacquemond M.; RT "Cucumber mosaic virus (CMV) populations in Tunisian pepper crops are RT mainly composed of virus reassortants with resistance-breaking properties"; RL Unpublished. XX DR MD5; 5c37de76197e9cf6ffce4e43ed7b4337. XX FH Key Location/Qualifiers FH FT source 1..539 FT /organism="Cucumber mosaic virus" FT /segment="RNA2" FT /host="Capsicum annuum" FT /isolate="KO47/96" FT /mol_type="genomic RNA" FT /country="Tunisia" FT /db_xref="taxon:12305" FT CDS <1..384 FT /codon_start=1 FT /transl_table=1 FT /gene="ORF2a" FT /product="RNA-dependent RNA polymerase, RdRp" FT /db_xref="GOA:K8DS95" FT /db_xref="UniProtKB/TrEMBL:K8DS95" FT /protein_id="CCK33420.1" FT /translation="AFKKYTANFQSYKELYYSDRRQCELINSFCSTEFRVERVNSNKQR FT KKYGIERRCNDKRRTPTGSYGGGEEAETKVSQTESTGTRSQKSQRESAFKSQTIPLPTV FT LPSRWFGTDRVMPPCERGGVTRV" FT CDS 143..475 FT /transl_table=1 FT /gene="ORF2b" FT /product="RNA silencing suppressor" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:Q8B3M6" FT /protein_id="CCK33421.1" FT /translation="MELNVGAMTNVELQLARMVEAKKQRRRSHKQNRRERGHKSPSERA FT RSNLRLFRFLPFYQVDGSELTGSCRHVNVAELPESEASRLELSAEDHDFDDTDWFAGNE FT WAEGAF" XX SQ Sequence 539 BP; 144 A; 121 C; 143 G; 131 T; 0 other; gcctttaaga agtataccgc taatttccag tcctacaaag aactctatta ttcagatcgt 60 cgtcagtgcg aattgatcaa ttcgttttgt agtacagagt tcagggttga gcgtgtaaat 120 tccaacaaac agcgaaagaa atatggaatt gaacgtaggt gcaatgacaa acgtcgaact 180 ccaactggct cgtatggtgg aggcgaagaa gcagagacga aggtctcaca aacagaatcg 240 acgggaacga ggtcacaaaa gtcccagcga gagagcgcgt tcaaatctca gactattccg 300 cttcctaccg ttctaccaag tagatggttc ggaactgaca gggtcatgcc gccatgtgaa 360 cgtggcggag ttacccgagt ctgaggcctc tcgtttagag ttatcggcgg aagaccatga 420 ttttgacgat acagattggt tcgccggtaa cgaatgggcg gaaggtgctt tctgaaacct 480 ccccttccgc atctccctcc ggttttctgt ggcgggagct gagttggcag tgttgctat 539 //