ID HE971587; SV 1; linear; genomic RNA; STD; VRL; 534 BP. XX AC HE971587; XX DT 25-NOV-2012 (Rel. 114, Created) DT 25-NOV-2012 (Rel. 114, Last updated, Version 1) XX DE Cucumber mosaic virus partial ORF2a gene and ORF2b gene, segment RNA2, DE genomic RNA, isolate EG3/09 XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-534 RA Jacquemond M.; RT ; RL Submitted (26-JUL-2012) to the INSDC. RL INRA, Station de Pathologie Vegetale, Domaine Saint Maurice, BP 9484143 RL Montfavet Cedex, FRANCE. XX RN [2] RA Ben Tamarzizt H., Montarry J., Girardot G., Fakhfakh H., Tepfer M., RA Jacquemond M.; RT "Cucumber mosaic virus (CMV) populations in Tunisian pepper crops are RT mainly composed of virus reassortants with resistance-breaking properties"; RL Unpublished. XX DR MD5; 897b41b0b21b5bbc0bde7ef93db052ba. XX FH Key Location/Qualifiers FH FT source 1..534 FT /organism="Cucumber mosaic virus" FT /segment="RNA2" FT /host="Capsicum annuum" FT /isolate="EG3/09" FT /mol_type="genomic RNA" FT /country="Tunisia" FT /db_xref="taxon:12305" FT CDS <1..384 FT /codon_start=1 FT /transl_table=1 FT /gene="ORF2a" FT /product="RNA-dependent RNA polymerase, RdRp" FT /db_xref="GOA:K8DSP0" FT /db_xref="UniProtKB/TrEMBL:K8DSP0" FT /protein_id="CCK33404.1" FT /translation="AFKKYTANFQSYKELYYSDRRQCELINSFCSTEFRVERVNSNKQR FT KKYGIERRCNDKRRTPTGSYGGGEEAETKVSQTESTGTRSQKSQRESAFKSQTIPLPTA FT LPSRWFGTDRVMPPCDRGGVTRV" FT CDS 143..475 FT /transl_table=1 FT /gene="ORF2b" FT /product="RNA silencing suppressor" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:K8DS84" FT /protein_id="CCK33405.1" FT /translation="MELNAGAMTNVELQLARMVEAKKQRRRSHKQNRRERGHKSPSERA FT RSNLRLFRFLPLYQVDGSELTGSCRHVIVAELPESEASRLELSAEDHDFDDTDWFAGNE FT WAEGAF" XX SQ Sequence 534 BP; 142 A; 123 C; 142 G; 127 T; 0 other; gcctttaaga agtacaccgc taatttccag tcctacaaag aactctatta ttcagatcgt 60 cgtcagtgcg aattgatcaa ttcgttttgt agtacagagt tcagggttga gcgtgtaaat 120 tccaacaaac agcgaaagaa atatggaatt gaacgcaggt gcaatgacaa acgtcgaact 180 ccaactggct cgtatggtgg aggcgaagaa gcagagacga aggtctcaca aacagaatcg 240 acgggaacga ggtcacaaaa gtcccagcga gagagcgcgt tcaaatctca gactattccg 300 cttcctaccg ctctaccaag tagatggttc ggaactgaca gggtcatgcc gccatgtgat 360 cgtggcggag ttacccgagt ctgaggcctc tcgtttagag ttatcggcgg aagaccacga 420 ttttgacgat acagattggt tcgccggtaa cgaatgggcg gaaggtgctt tctagaaccc 480 ccttcctctc cctccggttt tctgtggcgg gagctgagtt ggcagtgttg ctat 534 //