ID HE971568; SV 1; linear; genomic RNA; STD; VRL; 536 BP. XX AC HE971568; XX DT 25-NOV-2012 (Rel. 114, Created) DT 25-NOV-2012 (Rel. 114, Last updated, Version 1) XX DE Cucumber mosaic virus partial ORF2a gene and ORF2b gene, segment RNA2, DE genomic RNA, isolate DHH2.10/09 XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-536 RA Jacquemond M.; RT ; RL Submitted (26-JUL-2012) to the INSDC. RL INRA, Station de Pathologie Vegetale, Domaine Saint Maurice, BP 9484143 RL Montfavet Cedex, FRANCE. XX RN [2] RA Ben Tamarzizt H., Montarry J., Girardot G., Fakhfakh H., Tepfer M., RA Jacquemond M.; RT "Cucumber mosaic virus (CMV) populations in Tunisian pepper crops are RT mainly composed of virus reassortants with resistance-breaking properties"; RL Unpublished. XX DR MD5; c22d50fdf80427455d4c32b409133496. XX FH Key Location/Qualifiers FH FT source 1..536 FT /organism="Cucumber mosaic virus" FT /segment="RNA2" FT /host="Capsicum annuum" FT /isolate="DHH2.10/09" FT /mol_type="genomic RNA" FT /country="Tunisia" FT /db_xref="taxon:12305" FT CDS <1..384 FT /codon_start=1 FT /transl_table=1 FT /gene="ORF2a" FT /product="RNA-dependent RNA polymerase, RdRp" FT /db_xref="GOA:K8DV44" FT /db_xref="UniProtKB/TrEMBL:K8DV44" FT /protein_id="CCK33366.1" FT /translation="AFKKYTANFQSYKELYYSDRRQCELINSFCSTEFRVERVNSNKQR FT KKYGIERRCNDKRRTPTGSYGGGEEAETKVSQTESTGTRSQKSQRESAFKSQIVPLPTV FT LPSRWFGTDRVTPPCERGGVTRV" FT CDS 143..475 FT /transl_table=1 FT /gene="ORF2b" FT /product="RNA silencing suppressor" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:K8DRH4" FT /protein_id="CCK33367.1" FT /translation="MELNVGAMTNVELQLARMVEAKKQRRRSHKQNRRERGHKSPSERA FT RSNLRLFRFLPFYQVDGSELTGSRRHVNVAELPEYEASRLELSAEDHDFDDTDWFAGNE FT WAEGAL" XX SQ Sequence 536 BP; 144 A; 117 C; 143 G; 132 T; 0 other; gcctttaaga agtataccgc taatttccag tcctacaaag aactctatta ttcagatcgt 60 cgtcagtgcg aattgatcaa ttcgttttgt agtacagagt tcagggttga gcgtgtaaat 120 tccaacaaac agcgaaagaa atatggaatt gaacgtaggt gcaatgacaa acgtcgaact 180 ccaactggct cgtatggtgg aggcgaagaa gcagagacga aggtctcaca aacagaatcg 240 acgggaacga ggtcacaaaa gtcccagcga gagagcgcgt tcaaatctca gattgttccg 300 cttcctaccg ttttaccaag tagatggttc ggaactgaca gggtcacgcc gccatgtgaa 360 cgtggcggag ttacccgagt atgaggcctc tcgtttagag ttatcggcgg aagaccatga 420 ttttgacgat acagattggt tcgccggtaa cgaatgggcg gaaggtgctt tatgaaacct 480 ccccttcctc tccctccggt tttctgtggc gggagctgag ttggcagtgt tgctat 536 //