ID HE967665; SV 1; linear; genomic DNA; STD; VRL; 756 BP. XX AC HE967665; XX DT 05-OCT-2012 (Rel. 114, Created) DT 12-APR-2013 (Rel. 116, Last updated, Version 2) XX DE Pepper huasteco yellow vein virus cp gene for coat protein, isolate DE PHTLA62C2008 XX KW . XX OS Pepper huasteco yellow vein virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-756 RA Fraile A.; RT ; RL Submitted (20-JUL-2012) to the INSDC. RL Biotecnologia, Centro de Biotecnologia y Genomica de Plantas UPM-, Campus RL de Montegancedo, E-28223 Pozuelo de Alarcon (Madrid), SPAIN. XX RN [2] RX DOI; 10.1111/mec.12232. RX PUBMED; 23379795. RA Rodelo-Urrego M., Pagan I., Gonzalez-Jara P., Betancourt M., RA Moreno-Letelier A., Ayllon M.A., Fraile A., Pinero D., Garcia-Arenal F.; RT "Landscape heterogeneity shapes host-parasite interactions and results in RT apparent plant-virus codivergence"; RL Mol. Ecol. 22(8):2325-2340(2013). XX DR MD5; 819e5f72471ef8ed5d89765e72cd79dc. XX FH Key Location/Qualifiers FH FT source 1..756 FT /organism="Pepper huasteco yellow vein virus" FT /host="Capsicum annuum var. glabriusculum (chiltepin)" FT /isolate="PHTLA62C2008" FT /mol_type="genomic DNA" FT /country="Mexico:San Luis Potosi, Tlacuapa" FT /isolation_source="Monoculture" FT /collection_date="2008" FT /db_xref="taxon:223303" FT CDS 1..756 FT /transl_table=1 FT /gene="cp" FT /product="coat protein" FT /db_xref="GOA:K0N6D5" FT /db_xref="InterPro:IPR000263" FT /db_xref="InterPro:IPR000650" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:K0N6D5" FT /protein_id="CCJ67986.1" FT /translation="MPKRDAPWRLTAGTAKVSRTGNSSRALIMGPSTSRASAWVNRPMY FT RKPRIYRMYRSPDVPKGCEGPCKVQSFEQRHDVSHVGKVICISDVTRGNGITHRVGKRF FT CVKSVYILGKIWMDENIKLKNHTNSVMFWLVRDRRPYGTPMDFGQVFNMYDNEPSTATV FT KNDLRDRYQVMHRFYAKVTGGQYASNEQALVRRFWKVNNHVVYNHQEAGKYENHTENAL FT LLYMACTHASNPVYATLKIRVYFYDSIMN" XX SQ Sequence 756 BP; 203 A; 160 C; 193 G; 200 T; 0 other; atgcctaaac gtgatgctcc ttggcgatta acggcgggga ccgcaaaggt tagccgaact 60 ggcaacagtt cacgggctct aatcatgggc ccgagtacca gcagggcctc agcttgggtt 120 aatcgcccaa tgtacaggaa gccccggatt tatcgtatgt accgatctcc ggatgtgccg 180 aaaggttgtg aagggccgtg taaggtccaa tcgtttgaac aacgacatga tgtctctcat 240 gtgggtaagg ttatctgtat atccgatgtc actcgtggta atggtattac acatcgtgtt 300 ggcaaacgat tctgcgttaa gtccgtctac attcttggca aaatatggat ggacgaaaat 360 attaagttga agaaccatac caacagcgtc atgttttggt tggttaggga tcggagaccc 420 tacggtacgc ctatggattt tggccaagtg tttaacatgt atgacaatga gcccagcacc 480 gccactgtga agaacgatct tcgggatcgt tatcaagtta tgcataggtt ctatgctaag 540 gtcactggtg ggcaatatgc cagcaacgag caagctttgg tgcggcgttt ctggaaggtc 600 aacaaccatg ttgtgtacaa ccatcaggaa gctggcaaat atgagaacca cactgagaat 660 gcgctgttat tgtatatggc atgtacgcat gcatcaaatc ctgtatatgc aaccctcaaa 720 attcgggtct atttttatga ctcgataatg aattaa 756 //