ID HE795104; SV 1; linear; genomic RNA; STD; VRL; 843 BP. XX AC HE795104; XX DT 20-AUG-2012 (Rel. 113, Created) DT 05-NOV-2013 (Rel. 118, Last updated, Version 2) XX DE Sathuperi virus N and NSs genes, segment S, genomic RNA XX KW . XX OS Sathuperi orthobunyavirus OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Ellioviricetes; OC Bunyavirales; Peribunyaviridae; Orthobunyavirus. XX RN [1] RP 1-843 RA Hoeper D.; RT ; RL Submitted (19-MAR-2012) to the INSDC. RL Friedrich-Loeffler-Institute, Federal Resaerch Institute for Animal Health, RL Institue of Diagnostic Virology, Suedufer 10, Greifswald - Insel Riems RL 17493, GERMANY. XX RN [2] RX DOI; 10.3201/eid1810.120835. RX PUBMED; 23017842. RA Goller K.V., Hoper D., Schirrmeier H., Mettenleiter T.C., Beer M.; RT "Schmallenberg virus as possible ancestor of Shamonda virus"; RL Emerg. Infect. Dis. 18(10):1644-1646(2012). XX DR MD5; 00477cd3e21fc0afe065059fe4a25c8e. DR EuropePMC; PMC4507351; 26186514. XX CC related sequences HE795102, HE795103. XX FH Key Location/Qualifiers FH FT source 1..843 FT /organism="Sathuperi orthobunyavirus" FT /segment="S" FT /mol_type="genomic RNA" FT /db_xref="taxon:159141" FT CDS 44..745 FT /gene="N" FT /product="nucleocapsid protein" FT /db_xref="GOA:Q8QZ42" FT /db_xref="InterPro:IPR001784" FT /db_xref="UniProtKB/TrEMBL:Q8QZ42" FT /protein_id="CCG93489.1" FT /translation="MSSQFIFEDVPQRNAATFNPEVGYVAFIGKYGQQLNFGVARVFFL FT NQKKAKMVLHKTAQPSVDLTFGGVKFTVVNNHFPQYVSNPVPDNAITLHRMSGYLARWV FT ADTCKASVLKLAEASAQIVMPLAEVKGCTWADGYTMYLGFAPGAEMFLDAFDFYPLVIE FT MHRVLKDNMDVNFMKKVLRQRYGTMTAEEWMTQKITEIKAAFNSVGQLAWAKSGFSPAA FT RTFLQQFGINI" FT CDS 69..344 FT /gene="NSs" FT /product="non-structural protein" FT /db_xref="GOA:Q8QZ41" FT /db_xref="InterPro:IPR000797" FT /db_xref="UniProtKB/TrEMBL:Q8QZ41" FT /protein_id="CCG93490.1" FT /translation="MYHNGMQLHLTRRLGMWHLLVSMGSNSTSVLLESSSSTRRRPRWS FT YIRRHNQVSILLLVGSNSQWLITIFPNMSQILCQTMPSHFTGCRDI" XX SQ Sequence 843 BP; 240 A; 175 C; 183 G; 245 T; 0 other; ctgacatatt tcagtagtta atagtggaat acactactga aatatgtcaa gccaattcat 60 ttttgaagat gtaccacaac ggaatgcagc tacatttaac ccggaggttg ggtatgtggc 120 atttattggt aagtatgggc agcaactcaa cttcggtgtt gctagagtct tcttcctcaa 180 ccagaagaag gccaagatgg tcctacataa gacggcacaa ccaagtgtcg atcttacttt 240 tggtggggtc aaattcacag tggttaataa ccattttccc caatatgtct caaatcctgt 300 gccagacaat gccatcacac ttcacaggat gtcgggatat ctagcgcgat gggttgctga 360 cacatgcaag gctagtgtcc ttaagttggc tgaagcaagt gctcagattg tcatgcctct 420 tgctgaagtt aaaggttgca cttgggctga tggttataca atgtatcttg gattcgcacc 480 tggggcagaa atgttccttg atgcttttga cttctaccca ctggttatcg agatgcacag 540 ggttctcaaa gataatatgg atgtaaattt catgaaaaaa gtccttcgcc agcgctacgg 600 aacaatgact gcagaagaat ggatgactca aaaaataaca gaaattaagg ctgcgttcaa 660 ctccgttgga caacttgctt gggctaaatc tggattctct cctgctgcca gaactttctt 720 gcagcaattt ggtatcaaca tctaaacctc tccattacaa actcttaaat ttccgtgcaa 780 tatgtctatg tattgcacac cattatactg caaggcttct gttgagatag ttaataagtg 840 gag 843 //