ID HE654709; SV 1; linear; genomic RNA; STD; VRL; 720 BP. XX AC HE654709; XX DT 10-FEB-2012 (Rel. 111, Created) DT 10-FEB-2012 (Rel. 111, Last updated, Version 1) XX DE Rice yellow mottle virus CP gene for coat protein, genomic RNA, isolate DE Rw30 XX KW . XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Hebrard E.; RT ; RL Submitted (24-JAN-2012) to the INSDC. RL RPB, IRD, 911 av Agropolis BP64501, 34080 Montpellier, FRANCE. XX RN [2] RC sequenced in this study RA Ndikumana I., Gasore R., Issaka S., Pinel-Galzi A., Onasanya A., RA Hassani-Mehraban A., Fargette D., Peters D., Sere Y.; RT "Rice yellow mottle virus in rice in Rwanda: first report and evidence of RT strain circulation"; RL New Dis. Rep. 23:18-18(2011). XX DR MD5; 83b14141844cb97d3f2ad36ffe1c4ded. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Rw30" FT /mol_type="genomic RNA" FT /country="Rwanda" FT /db_xref="taxon:31744" FT CDS 1..720 FT /transl_table=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:H6SGX2" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:H6SGX2" FT /protein_id="CCF79537.1" FT /translation="MGRKGKKTSSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSSSWPVHSVEFLMDFKRSATSAEATTFNCVPFNLPRVWSLARCYSLWKPTRW FT DVIYLPEVSAATAGSIEMCYLYDYADAIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT TARNAVVASMDCSRVGWRRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVDDVPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 154 A; 191 C; 217 G; 158 T; 0 other; atgggcagga agggcaagaa aaccagctcc aaccagggtc agcaaggaaa gaagaagagt 60 cggcgtcccc gtgggcgttc ggcggagccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggacggt tcctggtcca ctatcttcta gctcctggcc ggtccactcc 180 gtggaattcc taatggattt taagcggagt gccacatcgg cagaagcgac gacattcaac 240 tgtgtgccgt tcaatctgcc tcgggtgtgg agtcttgcgc gttgttactc actgtggaag 300 ccaacacggt gggatgtcat ctacctccct gaggttagtg cggcgacagc tggaagtatc 360 gagatgtgct atctctacga ttacgctgac gccattccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctctagcgtt tggtacggcg ctgagggctg ccacttattg 480 agtggcggca cagcacggaa tgccgtggtc gcctcgatgg attgctctcg agtcggctgg 540 agacgcgtta ctagttcaat acctagtagc gtggatccca acgtcgtaaa taccatactg 600 ccagcaaggc tagctgtgcg gtcgtcgatc aaaccgacgg ttgatgatgt gccggggaaa 660 ctctacgcca tcgtcagtat ggtcttgcgg gatccggttg atccaacact caatacgtga 720 //